Recombinant Mouse Alpha-2B adrenergic receptor (Adra2b)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant mouse Adra2b is a 450-amino-acid G protein-coupled receptor (GPCR) with seven transmembrane domains . It is typically expressed in E. coli or yeast systems with an N-terminal His tag for purification . Key structural features include:

PropertySpecification
UniProt IDP30545 (Mouse)
Gene NameAdra2b
Protein Length450 amino acids
Expression SystemE. coli or Yeast
TagPolyhistidine (His)
Purity>90% (verified via SDS-PAGE)

The recombinant protein retains native conformation for ligand binding and signaling studies . Its sequence includes critical domains for G protein coupling (e.g., intracellular loops) and ligand-binding pockets .

Functional Characteristics

Adra2b regulates sympathetic nervous system activity, blood pressure, and stress responses . Key functional insights include:

  • Hypertension: Adra2b interacts with spinophilin to mediate vasoconstrictive responses; deletion impairs salt-sensitive hypertension in mice .

  • Emotional Memory: A deletion variant (lacking three glutamic acids) enhances emotional memory and amygdala reactivity, increasing susceptibility to PTSD-like phenotypes .

  • Neurotransmitter Regulation: Modulates stress-induced shifts from cognitive to habit memory via noradrenergic signaling .

Mechanistic Studies

  • Ligand Binding Assays: Used to screen α2B-selective agonists/antagonists (e.g., dexmedetomidine analogs) .

  • Signal Transduction: Elucidates G protein coupling (Gi/o pathways) and downstream effectors like adenylate cyclase .

Disease Models

  • Hypertension: Studies using Adra2b-knockout mice reveal its role in salt-dependent blood pressure regulation .

  • Neuropsychiatric Disorders: Links to PTSD, ADHD, and addiction via stress-response modulation .

Notable Research Findings

  • Zoladz et al. (2017): Demonstrated that Adra2b deletion variants amplify stress effects on long-term memory consolidation .

  • Che et al. (2015): Identified spinophilin as essential for Adra2b-mediated hypertensive responses .

  • Wirz et al. (2017): Showed Adra2b regulates stress-induced habit formation, suggesting therapeutic targets for addiction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Adra2b; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MVHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPHGLPQCELNQEAWYILASSIGS FFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPRPGPAAGGVPASAKVPTLV SPLSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAEKGA EEDEEEVEECEPQTLPASPASVFNPPLQQPQTSRVLATLRGQVLLSKNVGVASGQWWRRR TQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRQWTQTGW
Uniprot No.

Target Background

Function

Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase via G protein interaction.

Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does mouse Adra2b compare with human ADRA2B homolog?

The human ADRA2B and mouse Adra2b share high sequence homology but have distinct differences:

FeatureMouse Adra2bHuman ADRA2B
UniProt IDP30545P18089
Length450 amino acids450 amino acids
Sequence identityReferenceHigh homology with species-specific variations
Notable differencesContains species-specific residues affecting ligand bindingContains a polymorphic variant linked to decreased GRK-mediated phosphorylation

While both proteins function as alpha-2 adrenergic receptors, human ADRA2B has been more extensively studied for its association with conditions such as decreased basal metabolic rate in obese subjects, enhanced emotional memory, and familial epilepsy . Mouse models expressing Adra2b are valuable for comparative studies to understand receptor function across species and provide insights into human disease mechanisms .

What expression systems are optimal for producing recombinant Mouse Adra2b protein?

While multiple expression systems can be used for recombinant Mouse Adra2b production, each offers distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, simplicityLimited post-translational modifications, potential inclusion body formation
Mammalian cellsNative-like post-translational modifications, proper foldingHigher cost, lower yield, longer production time
Insect cellsHigher yield than mammalian cells, some post-translational modificationsIntermediate cost, glycosylation patterns differ from mammalian

According to the available product information, recombinant full-length Mouse Alpha-2B adrenergic receptor has been successfully expressed in E. coli with an N-terminal His tag . For functional studies requiring proper post-translational modifications, mammalian expression systems may be preferable, though E. coli-expressed protein is suitable for structural studies, antibody production, and certain binding assays .

What are the critical considerations for maintaining stability of recombinant Adra2b during storage and handling?

Maintaining stability of recombinant Mouse Adra2b is critical for experimental reproducibility. Key considerations include:

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles .

  • Buffer composition: Use Tris/PBS-based buffers with approximately 6% Trehalose at pH 8.0 for optimal stability .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • The standard 50% glycerol concentration provides optimal stability

  • Working conditions: Store working aliquots at 4°C for up to one week; repeated freeze-thaw cycles should be strictly avoided .

  • Lyophilization: The protein is typically supplied as a lyophilized powder, which enhances long-term stability prior to reconstitution .

What detection methods are most suitable for Mouse Adra2b research?

Multiple detection approaches can be employed depending on the research question:

MethodApplicationsAdvantagesLimitations
SDS-PAGEProtein purity assessment, molecular weight confirmationSimple, widely accessibleLimited sensitivity, qualitative
Western BlotProtein expression verification, semi-quantitative analysisSpecific detection, widely usedRequires specific antibodies, semi-quantitative
ELISAQuantitative detection in complex samplesHigh sensitivity, quantitativeRequires specific antibodies, limited structural insights
Flow CytometryCell surface expression, transfection efficiencySingle-cell analysis, quantitativeRequires viable cells, specific antibodies

Current recombinant Mouse Adra2b products have been validated for SDS-PAGE applications, with purity typically greater than 90% . For human ADRA2B, flow cytometry has been successfully employed using specific antibodies to detect the protein in transfected cells , suggesting similar approaches could be adapted for mouse Adra2b.

How can researchers effectively use ELISA for quantitative measurement of Mouse Adra2b?

ELISA provides a sensitive method for quantitative measurement of Mouse Adra2b in various sample types:

  • Sample preparation:

    • Suitable for tissue homogenates, cell lysates, and biological fluids

    • Samples must be diluted to fall within the mid-range of the assay (typically 0.156-10 ng/ml)

  • Assay considerations:

    • Colorimetric detection methods are commonly employed

    • Lyophilized standards are used for calibration curves

    • Optimize sample dilutions to ensure readings fall within the linear range

  • Performance factors:

    • Temperature and incubation time consistency is critical

    • Operation procedures and lab conditions should be strictly controlled

    • Ideally, the entire assay should be performed by the same researcher to minimize variation

  • Limitations:

    • ELISA kits are typically optimized for detection of native proteins

    • Detection of recombinant proteins may be challenging due to potential differences in sequence or tertiary structure

    • Specific validation is required when using recombinant proteins as standards

What signaling pathways are associated with Mouse Adra2b and how can they be studied?

Mouse Adra2b, like other α2-adrenergic receptors, plays critical roles in regulating neurotransmitter release from sympathetic nerves and adrenergic neurons in the central nervous system . Key signaling pathways include:

  • G-protein coupled signaling:

    • Primarily couples to inhibitory G proteins (Gi/Go)

    • Leads to inhibition of adenylyl cyclase and reduction in cAMP levels

    • Results in decreased protein kinase A (PKA) activity

  • Translational regulation:

    • Adra2b associates with eIF-2B, a guanine nucleotide exchange protein

    • This interaction influences regulation of protein translation

    • May explain some of the receptor's broader cellular effects

  • Experimental approaches for studying signaling:

    • cAMP assays to measure changes in second messenger levels

    • Calcium mobilization assays for intracellular Ca2+ dynamics

    • Receptor internalization and trafficking studies using fluorescently-tagged receptors

    • Phosphorylation studies to assess receptor desensitization

What are the challenges associated with antibody validation for Adra2b research?

Antibody validation is critical for generating reliable data in Adra2b research:

  • Specificity validation approaches:

    • Testing on tissues or cell lines known to express or not express Adra2b

    • Using knockout/knockdown models as negative controls

    • Comparing multiple antibodies targeting different epitopes

  • Common challenges:

    • Cross-reactivity with other alpha-2 adrenergic receptor subtypes due to high sequence homology

    • Conformational epitopes may be affected by sample preparation methods

    • Limited availability of validated antibodies for mouse Adra2b specifically

  • Validation strategies for flow cytometry applications:

    • Use transfected cell lines expressing Adra2b alongside control transfections

    • Employ appropriate controls to set quadrant markers based on control antibody staining

    • Validate staining protocols for membrane-associated proteins specifically

  • Performance characterization:

    • Determine optimal dilutions for each application empirically

    • Validate antibody performance in the specific experimental conditions

    • Consider generating custom antibodies if commercially available options are inadequate

How do antagonists interact with Mouse Adra2b compared to other adrenergic receptor subtypes?

Understanding antagonist profiles is crucial for pharmacological manipulation of Adra2b:

AntagonistRelative Affinity for Adra2bNotes on Selectivity
YohimbineHighestPreferred antagonist for alpha-2 receptors
ChlorpromazineHighLess selective, affects multiple receptor types
PhentolamineHighAlpha-adrenergic antagonist with moderate selectivity
MianserineModerateAlso affects serotonergic receptors
SpiperoneModerateAlso binds dopamine receptors
PrazosinLowerPrimarily alpha-1 selective
AlprenololLowBeta-adrenergic blocker with some alpha activity
PropranololLowPrimarily beta-adrenergic selective
PindololLowestPrimarily beta-adrenergic selective

The rank order for antagonist affinity is: yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol . This profile helps researchers select appropriate compounds for receptor blockade in experimental settings, with yohimbine being the preferred antagonist for selective Adra2b inhibition.

What functional differences exist between mouse Adra2b deletion variants and how do they compare to human polymorphisms?

While the search results don't specifically detail mouse Adra2b deletion variants, research on human ADRA2B variants provides comparative insights:

  • Human ADRA2B polymorphic variants:

    • A deletion variant has decreased G protein-coupled receptor kinase-mediated phosphorylation

    • This results in reduced receptor desensitization

    • Associated with reduced basal metabolic rate in obese subjects

    • May contribute to obesity pathogenesis

    • Related to enhanced emotional memory and increased focus on negative aspects of situations

  • Research implications:

    • Mouse models expressing human variant forms can help elucidate mechanisms

    • Comparative studies between mouse and human variants can reveal species-specific differences in receptor function

    • Understanding these variations is critical when translating findings from mouse models to human applications

  • Experimental design considerations:

    • Genotyping is essential when using primary cells or tissues

    • Recombinant expression should specify the variant being used

    • Functional studies should account for potential variant-specific differences in signaling

What strategies can address poor expression or solubility of recombinant Mouse Adra2b?

Membrane proteins like Adra2b often present expression and solubility challenges:

  • Optimization of expression conditions:

    • Modify induction parameters (temperature, inducer concentration, duration)

    • Test different E. coli strains designed for membrane protein expression

    • Consider codon optimization for the expression host

  • Fusion partners and solubility tags:

    • N-terminal His-tags have been successfully used

    • Consider larger solubility-enhancing tags (MBP, SUMO, etc.)

    • Test different tag positions (N-terminal vs. C-terminal)

  • Detergent screening:

    • Systematic testing of different detergent classes

    • Optimize detergent concentration for extraction

    • Consider detergent mixtures or addition of lipids

  • Alternative expression systems:

    • If E. coli yields poor results, consider insect or mammalian cells

    • Cell-free expression systems can sometimes overcome difficulties with toxic membrane proteins

How can researchers optimize storage conditions to prevent activity loss of Adra2b preparations?

Maintaining Adra2b activity requires careful attention to storage conditions:

  • Stability assessment:

    • Activity loss should be less than 5% within the expiration period under appropriate storage

    • Regular quality control testing is recommended for long-term studies

  • Optimal storage recommendations:

    • Store at -20°C to -80°C for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

    • For working stocks, store at 4°C for maximum of one week

  • Buffer optimization:

    • Tris/PBS-based buffers with 6% Trehalose at pH 8.0 enhance stability

    • Addition of glycerol (5-50% final concentration) improves freeze-thaw resistance

    • Consider adding protease inhibitors for sensitive preparations

  • Reconstitution best practices:

    • Centrifuge vials before opening

    • Use deionized sterile water for reconstitution

    • Prepare at concentrations between 0.1-1.0 mg/mL

    • Standardize reconstitution protocols to ensure consistency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.