Recombinant Mouse Amphiregulin (Areg)

Shipped with Ice Packs
In Stock

Description

Angiogenesis in Developing Lungs

Areg promotes endothelial cell (EC) tubule formation and survival in hyperoxic (HO) conditions, mitigating anti-angiogenic effects of hyperoxia . Studies in fetal murine lung ECs show:

  • Tubule Formation: Recombinant Areg (100 ng/mL) rescues HO-induced deficits in in vitro angiogenesis assays .

  • ERK1/2 Activation: Areg enhances phosphorylation of ERK1/2, a critical pathway for EC proliferation and survival .

  • Egfr Regulation: HO increases Areg mRNA but reduces Egfr expression, limiting signaling efficiency .

Tissue Repair and Fibrosis

Areg modulates lung recovery post-exposure to environmental bioaerosols:

  • Fibroblast Activity: Enhances wound closure and rescues dust extract-induced inhibitory effects on fibroblast recellularization .

  • Anti-Fibrotic Effects: In murine models, Areg-neutralizing antibodies exacerbate inflammation and fibrosis, while recombinant Areg accelerates resolution .

Immune Regulation

In autoimmune diseases like lupus nephritis (LN), Treg-derived Areg protects renal tissue:

  • Apoptosis Reduction: Areg diminishes apoptosis in mesangial and tubular cells .

  • Vascular Regeneration: Promotes endothelial cell sprouting and angiogenesis in in vitro assays .

Experimental Applications

Recombinant Areg is validated in diverse models:

ApplicationModel/Cell TypeKey FindingsSource
Bronchopulmonary Dysplasia (BPD)Neonatal mice (hyperoxia)Rescues EC tubule formation via ERK1/2
Lung FibrosisMurine fibroblasts (DE exposure)Enhances wound healing and fibroblast function
Lupus NephritisPristane-induced LN modelTreg-derived Areg reduces glomerular fibrosis
Cancer ResearchBreast/colon carcinoma cellsAutocrine growth factor in certain cell lines

Mechanisms of Action

Areg exerts effects primarily through EGFR-mediated signaling:

PathwayFunctionCell TypeSource
ERK1/2 ActivationProliferation, survival, and angiogenesisLung ECs, fibroblasts
EGFR BindingLower affinity than EGF but sufficient for signalingEpithelial cells
Apoptosis InhibitionProtects renal and lung tissue from cell deathMesangial cells, ECs

Challenges and Future Directions

While Areg shows therapeutic potential, challenges remain:

  • Cell-Specific Effects: Areg’s pro-angiogenic vs. pro-fibrotic roles depend on context (e.g., developmental stage, injury type) .

  • Targeted Delivery: Systemic administration risks off-target effects; localized delivery (e.g., intranasal) may improve efficacy .

  • Species-Specific Differences: Human vs. murine Areg share ~69% identity, necessitating caution in translational studies .

Future research should prioritize:

  1. Cell-Specific Knockout Models: To isolate Areg’s role in ECs vs. epithelial cells .

  2. Combination Therapies: Pairing Areg with anti-fibrotic agents for BPD treatment .

  3. Biomarker Development: Identifying Areg’s predictive value in diseases like LN .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Areg; Sdgf; Amphiregulin; AR; Schwannoma-derived growth factor; SDGF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
100-248
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLE VVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHL WKRYFREYEGETEERRRLRQENGTVHAIA
Uniprot No.

Target Background

Function
Recombinant Mouse Amphiregulin (AREG) is a ligand for the epidermal growth factor receptor (EGFR). It functions as an autocrine growth factor and mitogen for various cell types, including astrocytes, Schwann cells, and fibroblasts.
Gene References Into Functions

Amphiregulin's diverse roles are highlighted in the following studies:

  1. Promotes cardiac fibrosis post-myocardial infarction via EGFR pathway activation. PMID: 29349588
  2. HIF2-alpha induces myocardial AREG expression, enhancing myocardial ischemia tolerance. PMID: 29483579
  3. AREG transgenic mice exhibit reduced adipose tissue mass and altered gene expression in a colitis model. PMID: 29341420
  4. Regulatory T-cell-intrinsic amphiregulin is not essential for suppressive function. PMID: 27040371
  5. Activated alveolar macrophages produce amphiregulin, protecting against acute lung injury. PMID: 26808632
  6. AREG overexpression in osteoblasts induces a transient high bone mass phenotype. PMID: 26103093
  7. AREG silencing in keratinocytes regulates cell proliferation. PMID: 26802239
  8. Hepatic CD206-positive macrophages express amphiregulin to promote regulatory T cell immunosuppression in HBV infection. PMID: 26216935
  9. AREG may be involved in classically activated macrophages. PMID: 26365345
  10. IL-33-activated ILC2s express AREG, increasing after intestinal injury. PMID: 26243875
  11. AREG promotes HSC fibrogenic activity and is upregulated in NASH, suggesting potential for AR antagonists as antifibrotics. PMID: 25744849
  12. Factors upregulating AREG may influence mammary gland development and breast cancer risk. PMID: 23705924
  13. AREG is essential for ultraviolet therapy-induced contact hypersensitivity suppression. PMID: 25089660
  14. cAMP modulators and EGF-like peptides enhance mouse oocyte developmental competence. PMID: 24488930
  15. High-pressure ventilation activates Nrf2, inducing AREG and cytoprotective gene expression. PMID: 24921206
  16. AREG plays pro-neoplastic roles in colorectal carcinogenesis. PMID: 23263765
  17. Amphiregulin expression is regulated by the androgen/androgen receptor pathway. PMID: 23415714
  18. Amphiregulin enhances regulatory T cell suppression via the EGFR. PMID: 23333074
  19. Polycystin-1 regulates amphiregulin expression through CREB and AP1 signaling, impacting ADPKD cell proliferation. PMID: 22570239
  20. AR or AR-activated EGFR signaling is a potential therapeutic target for idiopathic pulmonary fibrosis. PMID: 23086930
  21. STAT6 regulates Alternaria-induced lung natural helper cell proliferation and amphiregulin expression. PMID: 22865552
  22. AREG-dependent EGFR signaling contributes to mucus cell metaplasia in lung injury. PMID: 22493011
  23. Lung tumor-associated dendritic cell-derived amphiregulin promotes cancer progression. PMID: 21742971
  24. EREG mediates signals downstream of Areg mRNA expression, and EGFR-ERBB2 signaling regulates ovulation. PMID: 21237132
  25. A TLR->MyD88->AREG/EREG->EGFR signaling pathway mediates protection against colitis. PMID: 21041656
  26. ATP from tumor cells stimulates AREG secretion from dendritic cells, potentially promoting tumorigenesis. PMID: 20651071
  27. AREG is not essential for inducing acute airway inflammation. PMID: 20414053
  28. AREG plays a critical role in intestinal epithelial growth. PMID: 20534719
  29. Forskolin increases AREG promoter activity in granulosa cells in a RIP140-dependent manner. PMID: 20308529
  30. Amphiregulin's role in bleomycin-induced pneumopathy in mice. PMID: 19915156
  31. Dmp1 binds to the genomic loci of Areg, Tsp-1, JunB, and Egr1. PMID: 19816943
  32. AREG mediates the function of mammary progenitor cells. PMID: 19913532
  33. Amphiregulin regulates hepatic acute-phase protein gene expression during inflammation and liver regeneration. PMID: 19815304
  34. Amphiregulin is a mitogen for adult neural stem cells. PMID: 12205669
  35. Amphiregulin binds to EGFR and stimulates lung epithelial cells upon tobacco smoke exposure. PMID: 12711607
  36. Amphiregulin, epiregulin, and beta-cellulin propagate LH signals in the ovulatory follicle. PMID: 14726596
  37. Castration increases EGF network growth factors in prostate cancer xenografts. PMID: 15651060
  38. Amphiregulin is a protective factor induced in response to liver damage. PMID: 15753092
  39. ADAM17 releases amphiregulin from mammary epithelial cells, crucial for mammary morphogenesis. PMID: 16079154
  40. TH2 cells express amphiregulin, linking type 2 immune response to gut epithelial cell proliferation. PMID: 17170297
  41. Amphiregulin is specifically required for puberty-induced ductal elongation in mammary gland development. PMID: 17369357
  42. Amphiregulin absence promotes spasmolytic polypeptide-expressing metaplasia in response to oxyntic atrophy. PMID: 17484876
  43. Amphiregulin plays a role in liver fibrosis, contributing to fibrogenic mediator expression and fibrogenic cell growth/survival. PMID: 18634036
  44. Amphiregulin contributes to glioma cell resistance to delta9-Tetrahydrocannabinol-induced apoptosis. PMID: 19229996
  45. AR-/- mice develop spasmolytic polypeptide expression metaplasia. PMID: 19230855
  46. Increased amphiregulin, betacellulin, and epiregulin expression in young erythropoietic protoporphyria mice. PMID: 19267999
  47. EGFR ligands, including AREG, are protective in acute lung injury and increase in Mt1/2-deficient mice. PMID: 16166738
Database Links

KEGG: mmu:11839

STRING: 10090.ENSMUSP00000031325

UniGene: Mm.8039

Protein Families
Amphiregulin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is amphiregulin and what are its primary biological functions?

Amphiregulin (Areg) is a member of the epidermal growth factor (EGF) family of cytokines, which includes at least ten proteins such as EGF, TGF-α, HB-EGF, and various heregulins. These cytokines are synthesized as transmembrane precursors characterized by one or several EGF structural units in their extracellular domain. Areg mediates cellular proliferation, differentiation, migration, survival, and repair processes. In developing lungs, it plays a crucial role in promoting branching morphogenesis and endothelial cell angiogenesis. Areg can function both as a growth promoter and, in certain tumor cell lines, as a growth inhibitor. It can act in both autocrine and paracrine manners to influence cellular behavior through EGFR signaling pathways .

What expression systems are used to produce recombinant mouse Areg, and how might this affect research applications?

Recombinant mouse Areg is primarily produced using E. coli expression systems. This bacterial expression approach offers advantages in terms of cost-effectiveness and high yield but may result in proteins lacking post-translational modifications present in mammalian-expressed proteins. The E. coli-derived mouse Amphiregulin protein typically spans amino acids Ser94-Lys191 of the native sequence. For research purposes, the bacterial expression system provides adequate bioactivity for most applications, with quality control measures ensuring >97% purity as determined by SDS-PAGE under reducing conditions and visualized by silver stain. The biological activity of these preparations is typically assessed in cell proliferation assays using Balb/3T3 mouse embryonic fibroblasts, with expected ED₅₀ values ranging from 5-20 ng/ml for properly folded and biologically active protein .

How is recombinant Areg used in angiogenesis research and what concentrations are effective?

Recombinant mouse Areg has been demonstrated to exert proangiogenic effects, particularly in developing murine lung endothelial cells exposed to hyperoxic conditions. In experimental settings, researchers typically treat murine fetal lung endothelial cells with up to 100 ng/mL of recombinant mouse amphiregulin protein for at least 1 hour before subjecting them to hyperoxia experiments. This treatment has been shown to mitigate the negative effects of hyperoxia on tubule formation ability, promoting in vitro lung angiogenesis upon hyperoxic exposure. The efficacy of Areg in angiogenesis research is often assessed through tubule formation assays, where the ability of endothelial cells to form vessel-like structures is quantified after treatment. Through these approaches, researchers have established that Areg deficiency inhibits while recombinant Areg treatment promotes fetal murine lung EC angiogenesis under hyperoxic conditions .

What cell lines and experimental models are most appropriate for studying Areg functions?

Several experimental models have proven effective for studying Areg functions. For endothelial cell biology research, the fetal murine lung endothelial cell line MFLM-91U has been widely used to study the effects of hyperoxia on EC biology in developing murine lungs. For bioactivity assays, Balb/3T3 mouse embryonic fibroblasts are commonly employed, with effective dosage (ED₅₀) typically ranging from 5-20 ng/ml. Additionally, Areg expression and function can be studied in various carcinoma cell lines and epithelial cells from tissues including colon, stomach, breast, ovary, and kidney. For in vivo studies, genetic loss-of-function and pharmacological gain-of-function approaches in neonatal mice exposed to normoxia or hyperoxia have been used to determine Areg expression and function. These diverse experimental models allow researchers to investigate Areg's role in different cellular contexts and pathological conditions, such as bronchopulmonary dysplasia (BPD) characterized by hindered lung angiogenesis and alveolarization .

How can researchers effectively measure Areg expression and activation in experimental samples?

Researchers can measure Areg expression at both mRNA and protein levels using several techniques. For mRNA quantification, real-time RT-PCR assays using gene-specific primers for amphiregulin (Areg; e.g., Mm01354339_m1 for mouse) can be performed on RNA isolated from cells or tissues of interest. For protein-level detection, flow cytometry using Alexa Fluor 647-conjugated anti-mouse Areg antibody (approximately 1:50 dilution) can be used to determine and quantify live Areg+ cells after appropriate cell preparation, including activation with phorbol-12-myristate 13-acetate (81 nM) and ionomycin (1.34 μM) for 4 hours. Areg signaling activation can be assessed by measuring downstream effectors such as phosphorylated extracellular signal-regulated kinase (ERK1/2) through western blotting. Additionally, the effects of Areg can be functionally assessed through tubule formation assays for angiogenic properties and cell proliferation assays for growth-promoting activities .

What are the optimal storage and handling conditions for maintaining recombinant mouse Areg bioactivity?

Recombinant mouse Areg is typically supplied in lyophilized form, filtered through a 0.2μm filter in PBS before lyophilization. For optimal storage and maintenance of bioactivity, the following conditions are recommended: Store the lyophilized protein at -20°C to -70°C for 6-12 months from the date of receipt. After reconstitution, the protein remains stable for approximately 1 month when stored at 2-8°C under sterile conditions, or for 3 months at -20°C to -70°C under sterile conditions. It is crucial to use a manual defrost freezer and avoid repeated freeze-thaw cycles, as these can significantly diminish the protein's bioactivity. When reconstituting and diluting the protein for experimental use, researchers should use sterile techniques and appropriate buffer solutions to maintain stability and activity. Proper storage and handling are essential to ensure the reproducibility and reliability of experimental results when working with recombinant mouse Areg .

What methodological approaches can be used to study Areg-EGFR signaling pathways in different cell types?

To study Areg-EGFR signaling pathways, researchers can employ various methodological approaches. Gene expression analysis using real-time RT-PCR with TaqMan gene-specific primers for both amphiregulin (Areg) and its receptor, epidermal growth factor receptor (Egfr), can assess baseline expression and changes in response to experimental conditions. Protein-level analyses using western blotting can detect activation of downstream signaling molecules such as phosphorylated ERK1/2, as growth factors acting via EGFR predominantly mediate their effects through this pathway. Functional assays such as tubule formation for endothelial cells can assess the biological outcomes of Areg-EGFR signaling. To establish causality, genetic loss-of-function studies using siRNA transfection to knock down Areg expression, and pharmacological gain-of-function studies using recombinant Areg treatment, can determine whether changes in signaling are either causative or adaptive events in cellular responses. Receptor binding assays using radiolabeled EGF competition can measure the binding affinity of different Areg forms to EGFR. These complementary approaches provide comprehensive insights into how Areg-EGFR signaling operates in different cellular contexts .

How can researchers effectively design and interpret Areg knockdown or knockout experiments?

When designing Areg knockdown or knockout experiments, researchers should consider several methodological factors to ensure interpretable results. For in vitro knockdown, siRNA transfection protocols should include appropriate controls (scrambled siRNA) and verification of knockdown efficiency through qRT-PCR and/or western blotting. Consideration of transfection timing is important as the half-life of both Areg mRNA and protein will affect the onset and duration of knockdown effects. For in vivo knockout models, researchers should account for potential compensatory mechanisms from other EGF family members that may obscure Areg-specific effects. When interpreting results, it's crucial to distinguish between direct effects of Areg deficiency and secondary consequences. For example, in studies of lung endothelial cells, Areg deficiency has been shown to potentiate hyperoxia-mediated anti-angiogenic effects, but these must be examined in the context of other signals affecting angiogenesis. Researchers should also consider that Areg acts both in autocrine and paracrine manners, so cell type-specific knockout models may be necessary to differentiate these effects. Finally, comparing loss-of-function (knockdown/knockout) with gain-of-function (recombinant Areg treatment) experiments provides stronger evidence for the causal role of Areg in observed phenotypes .

How does recombinant Areg with COOH-terminal extensions differ in receptor binding and bioactivity from standard forms?

Research has revealed significant functional differences between different recombinant Areg forms based on their C-terminal regions. The standard form of recombinant Areg (rAR84), corresponding to the 84-amino acid mature secreted polypeptide, competes poorly for binding of radiolabeled EGF to the EGF receptor and demonstrates limited ability to stimulate growth of Balb/c/3T3 cells. In striking contrast, recombinant forms with COOH-terminal extensions corresponding to sequences from the AR precursor (rAR87 and rAR92) exhibit dramatically enhanced functional properties. Specifically, rAR87 possesses 42-fold greater receptor binding activity and 55-fold greater bioactivity compared to rAR84. Similarly, rAR92 shows 20-fold greater receptor binding activity and 14-fold greater bioactivity. These findings suggest that the C-terminal domain plays a critical role in determining Areg's interaction with EGFR and subsequent biological effects. Researchers studying Areg function should therefore carefully consider which recombinant form they use, as this choice can profoundly impact experimental outcomes and interpretations. For studies requiring maximal bioactivity, the extended forms (particularly rAR87) would be preferable to the standard rAR84 form .

How does the mechanism of Areg-induced angiogenesis differ from other angiogenic factors in various pathophysiological contexts?

Amphiregulin-induced angiogenesis operates through distinct mechanisms compared to traditional angiogenic factors like VEGF, FGF, or angiopoietins. While these classical factors often act directly on specialized angiogenic signaling pathways, Areg functions primarily through EGFR signaling, which is not traditionally associated with vascular development. Research indicates that in hyperoxia-exposed developing lungs, Areg promotes endothelial cell tubule formation via ERK1/2 activation. Specifically, Areg treatment increases both p-ERK1 and p-ERK2 activation in hyperoxic conditions, with the extent of hyperoxia-induced ERK2 activation being significantly greater in Areg-treated cells than in vehicle-treated cells. This distinguishes Areg from factors like VEGF, which signals primarily through VEGFR-mediated pathways involving PI3K/Akt. Additionally, Areg uniquely serves as a bridge between epithelial and endothelial compartments, as it is expressed in epithelial cells, smooth muscle cells, mesenchymal cells, and resident Tregs, but can act on endothelial cells that express EGFR. This suggests Areg may coordinate tissue repair and regeneration across multiple cell types simultaneously. Furthermore, unlike some angiogenic factors, Areg appears to have context-dependent effects—functioning as both a promoter of angiogenesis in developing lungs and as a growth inhibitor in certain tumor contexts. This dual nature makes Areg particularly interesting for understanding the nuanced regulation of angiogenesis in different pathophysiological scenarios .

What approaches can resolve contradictory findings regarding Areg effects in different experimental systems?

Contradictory findings regarding Areg effects across different experimental systems can be resolved through several methodological and analytical approaches. First, standardization of recombinant Areg preparations is crucial, as different forms (e.g., rAR84 vs. rAR87) have dramatically different bioactivities. Research has demonstrated that rAR87 possesses 55-fold greater bioactivity than rAR84, which could easily account for apparently conflicting results if different studies used different forms. Second, researchers should carefully consider the cellular context, including the expression levels of EGFR and the activation status of downstream signaling components. The observed decrease in EGFR expression under hyperoxic conditions despite increased Areg levels suggests complex regulatory mechanisms that must be accounted for. Third, dose-response relationships should be comprehensively characterized, as Areg may exert different or even opposing effects at different concentrations. Fourth, the timing of Areg administration or inhibition relative to developmental or pathological processes is critical—early intervention may yield different outcomes than late intervention. Finally, integration of in vitro findings with in vivo models is essential, as the complex multicellular environment in vivo may significantly modify Areg effects observed in isolated cell systems. By addressing these factors systematically, researchers can reconcile seemingly contradictory findings and develop a more nuanced understanding of Areg's context-dependent activities .

What analytical frameworks best capture the multifaceted roles of Areg in development, homeostasis, and disease?

To fully capture the multifaceted roles of Areg in development, homeostasis, and disease, researchers should employ analytical frameworks that integrate multiple levels of biological organization and temporal dynamics. A systems biology approach is particularly valuable, incorporating: (1) Molecular-level analysis of Areg-EGFR binding kinetics and downstream signaling networks, including quantitative assessment of ERK1/2 activation and other pathways; (2) Cellular-level analysis of context-specific responses across different cell types, including endothelial cells, epithelial cells, and immune cells; (3) Tissue-level analysis of how Areg coordinates processes such as angiogenesis and epithelial development in organs like the lung; (4) Temporal analysis tracking how Areg functions change across developmental stages and disease progression; and (5) Comparative analysis across different pathological conditions, such as developmental disorders (bronchopulmonary dysplasia) versus cancers, to identify consistent and divergent mechanisms. This multi-scale analytical framework should also incorporate genetic and pharmacological perturbations to establish causality. For example, research has shown that Areg deficiency inhibits while recombinant Areg treatment promotes fetal murine lung EC angiogenesis under hyperoxic conditions, demonstrating causality through complementary loss-of-function and gain-of-function approaches. By integrating these diverse analytical perspectives, researchers can develop comprehensive models of how Areg functions as a key regulatory node in complex biological networks spanning development, homeostasis, and disease states .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.