Recombinant Mouse Androgen-dependent TFPI-regulating protein (Adtrp)

Shipped with Ice Packs
In Stock

Description

Production and Validation

Expression system: Synthesized via cell-free protein synthesis (CFPS) using Nicotiana tabacum (tobacco) extracts .

Quality control:

ParameterDetail
Purity>90% (SDS-PAGE verified)
ApplicationsELISA, Western blot, SDS-PAGE
Species reactivityMouse-specific epitopes

Biological Functions

ADTRP regulates vascular integrity through two primary mechanisms:

Coagulation Pathway Modulation

  • Enhances Tissue Factor Pathway Inhibitor (TFPI) expression and anticoagulant activity in endothelial cells .

  • Androgen-dependent regulation occurs via androgen-response elements in the ADTRP promoter .

Wnt/β-Catenin Signaling Inhibition

  • Suppresses canonical Wnt signaling downstream of LRP6 phosphorylation and upstream of GSK3β .

  • Deficiency increases MMP-9 expression in endothelial/mast cells, causing vascular leakage .

Vascular Phenotypes in Adtrp−/− Models

SpeciesPhenotypeMechanism
MiceDilated vessels, hemorrhage, 40% lethalityReduced VE-cadherin/claudin-5
ZebrafishEdema, ectopic Wnt activationMMP-9 upregulation

Gene expression changes in Adtrp−/− mice (P0 pups):

GeneFunctionFold Change vs. WT
Cdh5Endothelial junctions0.46↓
Cldn5Endothelial barrier0.39↓
Mmp9Matrix degradation3.2↑
Klf4Permeability regulation0.18↓

Pharmacological Interactions

ADTRP expression is modulated by:

  • PPARα agonists (e.g., Wy14643): Induces hepatic Adtrp via PPREs in intron 1

  • Heavy metals: Copper increases Adtrp mRNA

  • Toxicants: Perfluorooctanoic acid upregulates Adtrp, while valproic acid suppresses it

Research Applications

  • Vascular stability assays: Detects junctional protein deficits in Adtrp−/− models

  • Wnt pathway studies: Used to rescue ectopic β-catenin signaling

  • Coagulation studies: Quantifies TFPI activity in endothelial cells

Clinical Implications

  • Cardiovascular diseases: ADTRP SNPs correlate with venous thromboembolism and coronary artery disease

  • Therapeutic targeting: Wnt/MMP-9 axis inhibition reverses vascular defects in preclinical models

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Please note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
Adtrp; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Adtrp
Target Protein Sequence
MTKTTTCVYHFLVLNWYIFLNYHIPQIGRNEEKLREFHDGGRSKYLTLLNLLLQAIFFGV ACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDD FFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNW VYPVFDSLSPLGIIIFFSAAYILVAGIYLFGEKINHWKWGAIAKPQMKKN
Uniprot No.

Target Background

Function
Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Exhibits a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Database Links
Protein Families
AIG1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Adtrp and what is its primary function in vascular biology?

Adtrp (Androgen-dependent TFPI-regulating protein) is a novel protein first identified in 2011 that plays multiple roles in vascular biology. Its primary function involves regulating the expression and activity of Tissue Factor Pathway Inhibitor (TFPI), which is the major inhibitor of the Tissue Factor-dependent pathway of coagulation on endothelial cells . Research has demonstrated that Adtrp regulates both native and androgen-enhanced TFPI expression in cultured endothelial cells . Beyond TFPI regulation, Adtrp also demonstrates a critical role in vascular development and maintenance of vessel integrity through Wnt signaling-dependent regulation of matrix metalloproteinase-9 (MMP-9) . Additionally, it hydrolyzes fatty acid esters of hydroxy-fatty acids that possess anti-diabetic and anti-inflammatory properties, suggesting a multifaceted role in vascular homeostasis .

How is Adtrp expression regulated at the molecular level?

Adtrp expression is primarily regulated by androgens through direct binding of the androgen receptor to a half-androgen response element (half-ARE) in the Adtrp promoter region. Specifically, the sequence TGTTCT has been experimentally confirmed as critical for the transcriptional activation of Adtrp by testosterone . Multiple prediction algorithms have identified potential half-AREs (AGAACA and TGTTCT) in the Adtrp promoter . Mutagenesis studies have definitively demonstrated that this half-ARE is essential for androgen-mediated transcriptional activation . This regulatory relationship explains the "androgen-dependent" aspect of the protein's nomenclature and provides important context for experimental design when studying Adtrp function under various hormonal conditions.

What cellular localization patterns does Adtrp exhibit?

Adtrp is primarily located in lipid rafts/caveolae of the cell membrane, where it colocalizes with both TFPI and caveolin-1 (Cav-1) . The protein contains potential palmitoylation sites at Cys7 and Cys62/79, along with predicted transmembrane domains that likely facilitate its anchoring in lipid rafts . Immunostaining experiments have confirmed that Adtrp does not relocate to the nuclei after androgen treatment, suggesting it is unlikely to function as a transcription factor directly . This membrane localization pattern is functionally significant as it positions Adtrp to influence the distribution and activity of TFPI, particularly in the detergent-resistant membrane fraction associated with lipid rafts.

What are the optimal methods for expressing and purifying recombinant mouse Adtrp?

For successful expression and purification of recombinant mouse Adtrp, a mammalian expression system is recommended over bacterial systems due to the importance of post-translational modifications, particularly palmitoylation. The most effective approach involves:

  • Cloning the full-length mouse Adtrp cDNA into a mammalian expression vector with a C-terminal FLAG or His-tag

  • Transfecting HEK293T cells using lipofection methods

  • Selecting stable transfectants using appropriate antibiotics

  • Harvesting cells and solubilizing membrane fractions with mild detergents (1% Triton X-100 supplemented with 0.1% sodium deoxycholate)

  • Purifying using affinity chromatography with anti-FLAG or nickel columns

  • Verifying purity using SDS-PAGE and Western blotting

This method preserves the functional properties of Adtrp, particularly its ability to interact with TFPI and influence Wnt signaling pathways .

What experimental approaches effectively measure Adtrp activity in vitro?

Assessing Adtrp activity requires multiple complementary approaches:

  • TFPI Regulatory Activity: Measure TFPI mRNA expression via qRT-PCR and protein levels via ELISA after Adtrp overexpression or knockdown. The functional impact can be determined through FXa inhibition assays, which quantify TFPI-dependent anticoagulant activity .

  • Wnt Signaling Regulation: Utilize TOPFlash/FOPFlash luciferase reporter assays to assess Adtrp's effects on canonical Wnt/β-catenin signaling. These cell-based reporter assays have revealed that Adtrp negatively regulates canonical Wnt signaling, affecting membrane events downstream of low-density lipoprotein receptor-related protein 6 (LRP6) and upstream of glycogen synthase kinase 3 beta .

  • Lipid Metabolism Function: Employ LC-MS/MS to measure the hydrolysis of fatty acid esters of hydroxy-fatty acids in the presence of purified Adtrp, assessing its enzymatic activity .

These complementary approaches provide a comprehensive assessment of Adtrp's multiple functional roles.

What are the recommended animal models for studying Adtrp function in vivo?

Two primary animal models have proven valuable for in vivo Adtrp research:

  • Mouse Models: Global Adtrp knockout mice exhibit vascular malformations, perivascular inflammation, and microhemorrhages, particularly evident in newborns. These models are ideal for studying long-term physiological impacts, including effects on hemostasis, vascular development, and matrix metalloproteinase regulation .

  • Zebrafish Models: Morpholino-based knockdown of adtrp in zebrafish embryos produces vascular malformations in the low-pressure vasculature similar to those observed in mice. The optical transparency of zebrafish embryos makes them particularly valuable for real-time visualization of vascular development and integrity using transgenic fluorescent reporter lines .

Both models demonstrate that Adtrp deficiency leads to increased aberrant/ectopic Wnt/β-catenin signaling and upregulation of matrix metallopeptidase-9 (MMP-9), highlighting the evolutionary conservation of Adtrp function across vertebrates .

How does Adtrp influence the Wnt signaling pathway, and what are the implications for vascular development?

Adtrp functions as a negative regulator of canonical Wnt signaling through a mechanism that affects membrane events downstream of LRP6 and upstream of glycogen synthase kinase 3 beta . This regulatory relationship has significant implications for vascular development:

  • Mechanism: Cell-based reporter assays demonstrate that Adtrp deficiency increases aberrant Wnt/β-catenin signaling, which subsequently upregulates MMP-9 expression in endothelial cells and mast cells .

  • Phenotypic Consequences: Adtrp-deficient mouse pups and zebrafish embryos exhibit vascular malformations characterized by vessel dilation/tortuosity, decreased extracellular matrix content, and deficient perivascular cell coverage .

  • Experimental Evidence: The causative relationship between increased Wnt signaling and vascular defects has been established through rescue experiments, where Wnt-pathway inhibition reversed the increased mmp9 expression in zebrafish embryos lacking Adtrp .

  • Cellular Manifestations: The vascular lesions in Adtrp-deficient animals display accumulated mast cells, decreased endothelial junction components (VE-cadherin and claudin-5), and increased vascular permeability .

These findings position Adtrp as a critical mediator between androgen signaling, Wnt pathway activity, and vascular integrity through the regulation of extracellular matrix composition.

What is the relationship between Adtrp and TFPI at the molecular and functional levels?

The relationship between Adtrp and TFPI is complex and operates at multiple levels:

  • Transcriptional Regulation: In vitro studies demonstrate that Adtrp regulates TFPI mRNA expression, with Adtrp-shRNA reducing and Adtrp overexpression enhancing TFPI mRNA levels in endothelial cells .

  • Membrane Colocalization: Adtrp colocalizes with TFPI in lipid rafts/caveolae and enhances the colocalization of the TF-FVIIa–FXa-TFPI complex with caveolin-1, suggesting a role in organizing these anticoagulant complexes at the cell surface .

  • Androgen-Mediated Enhancement: Dihydrotestosterone up-regulates both TFPI and Adtrp expression and increases FXa inhibition by TFPI in an Adtrp- and caveolin-1-dependent manner .

  • In Vivo Complexity: Interestingly, while Adtrp deficiency in mice does not significantly reduce Tfpi expression, it does affect TFPI-dependent lung-associated anticoagulant activity, suggesting that Adtrp primarily regulates TFPI's membrane location and functional activity rather than its expression in vivo .

This multifaceted relationship highlights Adtrp's role as both a transcriptional regulator and a membrane organizer that optimizes TFPI's anticoagulant function.

How do single nucleotide polymorphisms in ADTRP correlate with cardiovascular disease risk?

Single nucleotide polymorphisms (SNPs) in the ADTRP gene have been associated with cardiovascular disease (CVD) risk through multiple independent studies:

  • Disease Associations: SNPs in ADTRP associate with coronary artery disease, myocardial infarction, and deep vein thrombosis/venous thromboembolism .

  • Potential Mechanisms: These associations likely reflect Adtrp's multiple roles in:

    • Maintaining vascular integrity through Wnt signaling regulation

    • Supporting TFPI anticoagulant activity

    • Modulating inflammatory processes through effects on mast cells and matrix metalloproteinases

    • Metabolizing bioactive lipids with anti-diabetic and anti-inflammatory properties

  • Research Challenges: Current research has not definitively established whether these polymorphisms are causative or merely markers in linkage disequilibrium with other functional variants. Additionally, the relative contribution of TFPI-dependent versus Wnt signaling-dependent mechanisms remains unclear .

This represents a significant area for future research, particularly in determining how specific ADTRP variants mechanistically influence cardiovascular disease development.

What are common difficulties in detecting endogenous mouse Adtrp and how can they be overcome?

Detecting endogenous mouse Adtrp presents several challenges:

  • Low Expression Levels: Endogenous Adtrp is often expressed at relatively low levels in many tissues, making detection difficult.

    • Solution: Implement signal amplification techniques such as tyramide signal amplification for immunohistochemistry or use highly sensitive ELISA kits specifically designed for mouse Adtrp.

  • Antibody Specificity: Commercial antibodies may cross-react with other proteins of similar structure.

    • Solution: Validate antibodies using positive controls (Adtrp-overexpressing cells) and negative controls (Adtrp knockout tissues). Western blotting should show bands at the expected molecular weight of 27-29 kDa .

  • Membrane Localization: The membrane association of Adtrp can complicate extraction and detection.

    • Solution: Use detergent-based extraction methods optimized for membrane proteins, such as Triton X-114 extraction which effectively separates detergent-resistant membrane fractions where Adtrp is predominantly located .

  • Post-translational Modifications: Palmitoylation and other modifications can affect antibody binding.

    • Solution: Use multiple antibodies targeting different epitopes to ensure detection regardless of post-translational modification status.

These technical approaches significantly improve the reliability of endogenous Adtrp detection in experimental systems.

How can researchers effectively modulate Adtrp expression for functional studies?

For robust functional studies, researchers can modulate Adtrp expression using several complementary approaches:

  • Genetic Knockdown/Knockout:

    • shRNA Approach: Lentiviral delivery of ADTRP-specific shRNA provides effective knockdown in cultured endothelial cells .

    • CRISPR-Cas9: For complete knockout in cell lines, targeting exons encoding critical transmembrane domains yields highest functional impact.

    • Inducible Systems: Tet-on/off systems allow temporal control of Adtrp expression, particularly valuable for distinguishing developmental versus homeostatic roles.

  • Overexpression Systems:

    • Expression Vectors: Plasmids containing full-length Adtrp cDNA with C-terminal epitope tags (FLAG, HA) preserve function while enabling detection .

    • Viral Delivery: Adeno-associated viral vectors provide efficient in vivo delivery for tissue-specific overexpression.

  • Pharmacological Modulation:

    • Androgen Treatment: Dihydrotestosterone (1-10 nM range) reliably increases Adtrp expression in endothelial cells after 24-48 hours of treatment .

    • AR Antagonists: Flutamide or enzalutamide can reduce androgen-dependent Adtrp expression.

  • Rescue Experiments:

    • Expressing wild-type Adtrp in knockout backgrounds provides critical validation of phenotype specificity.

    • Domain mutants can identify critical regions for specific functions (e.g., TFPI regulation versus Wnt signaling regulation).

Each approach has specific advantages depending on the research question and experimental system.

What are the critical considerations when designing experiments to study Adtrp's multiple functions?

When investigating Adtrp's diverse functions, researchers should consider several critical factors:

  • Function-Specific Readouts: Design experiments with multiple readouts to capture Adtrp's diverse activities:

    • TFPI expression and activity for coagulation effects

    • Wnt reporter assays for signaling effects

    • MMP-9 activity assays for matrix remodeling effects

    • Vascular permeability measurements for barrier function

  • Sex Differences: Due to Adtrp's androgen responsiveness, include both male and female samples in all experiments, as baseline expression and responses to treatments may differ significantly between sexes .

  • Developmental Timing: The effects of Adtrp deficiency are most pronounced during development, with partially penetrant lethality in newborns. Consider developmental stage-specific analyses, particularly for vascular integrity studies .

  • Tissue Specificity: Adtrp's effects may vary by vascular bed, with low-pressure vasculature showing greater sensitivity to Adtrp deficiency. Include multiple vascular beds in analyses .

  • System Integration: Design experiments to distinguish direct versus indirect effects by integrating:

    • Cell-autonomous effects (isolated endothelial cells)

    • Cell-cell interaction effects (co-culture systems with mast cells)

    • Systemic effects (in vivo models)

These considerations ensure experimental designs that can effectively parse Adtrp's multiple functions and provide mechanistic insights into its diverse roles.

What are the most promising therapeutic applications related to Adtrp modulation?

Based on current research, several therapeutic applications related to Adtrp modulation show particular promise:

  • Cardiovascular Disease Prevention: Enhancing Adtrp expression or activity could potentially reduce thrombotic risk by increasing TFPI activity and improving vascular integrity. This approach might be particularly valuable in populations with identified ADTRP polymorphisms associated with increased CVD risk .

  • Vascular Stabilization: Adtrp's role in maintaining vascular integrity through Wnt signaling regulation suggests potential applications in conditions characterized by vascular leakage or malformation, such as diabetic retinopathy or tumor angiogenesis .

  • Metabolic Disorder Management: Adtrp's ability to hydrolyze fatty acid esters of hydroxy-fatty acids, which have anti-diabetic and anti-inflammatory effects, positions it as a potential target for metabolic disorder interventions .

  • Androgen Replacement Therapy Enhancement: Understanding Adtrp's role in mediating the vascular protective effects of androgens could inform improved approaches to androgen replacement therapy that maximize cardiovascular benefits while minimizing risks .

These therapeutic directions warrant further investigation, particularly regarding tissue-specific targeting strategies and potential unintended consequences of systemic Adtrp modulation.

What unresolved questions remain about Adtrp's physiological roles?

Despite significant progress in understanding Adtrp, several important questions remain unresolved:

  • Hierarchical Importance of Functions: It remains unclear whether Adtrp's primary physiological role relates to coagulation (via TFPI), vascular development (via Wnt signaling), or lipid metabolism. Determining which function predominates under different conditions is essential for targeted therapeutic approaches .

  • Tissue-Specific Functions: While vascular endothelium has been the primary focus of Adtrp research, the protein is expressed in multiple tissues. The extent to which its functions differ across tissues remains poorly characterized .

  • Interaction Partners: Beyond TFPI and caveolin-1, the complete set of Adtrp-interacting proteins remains unidentified. Comprehensive interactome studies could reveal additional functions and regulatory mechanisms .

  • Signaling Integration: How Adtrp integrates androgen signaling, Wnt pathway activity, and coagulation cascade regulation remains mechanistically unclear. Identifying the molecular connections between these pathways could provide valuable insights .

  • Evolutionary Conservation: While functional similarities exist between vertebrate models, the evolutionary history of Adtrp and how its functions may have specialized across species remain unexplored .

Addressing these questions will require integrated approaches combining molecular, cellular, and physiological methodologies across multiple model systems.

What emerging technologies might advance our understanding of Adtrp biology?

Several emerging technologies hold particular promise for advancing Adtrp research:

  • Single-Cell Transcriptomics: Applying single-cell RNA sequencing to Adtrp-deficient models could reveal cell type-specific responses and identify previously unrecognized cellular targets .

  • Spatial Proteomics: Technologies that map protein localization with subcellular resolution could clarify how Adtrp influences the distribution of TFPI and other proteins within specific membrane microdomains .

  • CRISPR-Based Screening: Genome-wide CRISPR screens in Adtrp-modulated backgrounds could identify synthetic lethal interactions and novel functional connections .

  • Live-Cell Super-Resolution Microscopy: These techniques could visualize the dynamic interactions between Adtrp, TFPI, and membrane components in real-time, providing insights into the temporal aspects of Adtrp function .

  • Patient-Derived Organoids: Developing vascular organoids from patients with ADTRP polymorphisms could provide physiologically relevant models for studying human-specific aspects of Adtrp function .

  • Computational Modeling: Integrating the multiple functions of Adtrp into systems biology models could help predict context-dependent effects and guide experimental design .

These technological approaches, particularly when combined, have the potential to resolve outstanding questions about Adtrp's diverse functions and their integration in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.