Recombinant Mouse Apolipoprotein C-I (Apoc1)
Shipped with Ice Packs 
In Stock 
Description
Introduction to Recombinant Mouse Apolipoprotein C-I (Apoc1)
Recombinant Mouse Apolipoprotein C-I (Apoc1) is a synthetic version of the endogenous protein, engineered for research purposes. Native Apoc1 is a 6.6 kDa apolipoprotein involved in lipid metabolism, primarily associated with VLDL and HDL particles. The recombinant form retains core functional domains but often includes modifications such as N-terminal His/GST tags and utilizes expression systems like E. coli or cell-free platforms to enhance yield and solubility .
Primary Roles in Lipid Metabolism
Key Experimental Insights
Pathophysiological Roles
-
Hypertriglyceridemia:
-
Cardiovascular Risk:
-
Metabolic Regulation:
Product Specs
Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol. Note: Specify your desired glycerol concentration in order comments if different from the default.
Form
Available in liquid or lyophilized powder format. Note: We prioritize shipping the available format; however, please specify your preferred format in the order comments for custom preparation.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Apoc1; Apolipoprotein C-I; Apo-CI; ApoC-I; Apolipoprotein C1
Datasheet & Coa
Please contact us to get it.
Expression Region
27-88aa
Mol. Weight
12.5 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.
Target Background
Function
Recombinant Mouse Apolipoprotein C-I (ApoC1) is an inhibitor of lipoprotein binding to the low-density lipoprotein (LDL) receptor, LDL receptor-related protein, and very-low-density lipoprotein (VLDL) receptor. It associates with high-density lipoproteins (HDL) and triacylglycerol-rich lipoproteins in plasma, comprising approximately 10% of VLDL protein and 2% of HDL protein. ApoC1 directly interferes with fatty acid uptake and is the major plasma inhibitor of cholesteryl ester transfer protein (CETP). It modulates the interaction of APOE with beta-migrating VLDL and inhibits beta-VLDL binding to the LDL receptor-related protein. Furthermore, ApoC1 binds free fatty acids, reducing their intracellular esterification.
Gene References Into Functions
Key Research Findings on ApoC1:
- APOC1 expression induces glomerulosclerosis, potentially by increasing the cytokine response in macrophages. (PMID: 27976371)
- Apolipoprotein C-I was significantly increased in obese mice plasma. (PMID: 22404376)
- ApoC-I deficiency results in impaired memory functions, suggesting a critical, bell-shaped dose-dependent role in brain function. (PMID: 21157034)
- ApoC-I's stimulatory effect on the lipopolysaccharide (LPS) response resembles that of LPS-binding protein (LBP) and depends on CD14/Toll-like receptor 4 signaling. (PMID: 20335569)
- Regulates gene cluster expression in macrophages. (PMID: 12032151)
- Potently inhibits CETP in vivo. (PMID: 12070157)
- Lipoprotein remnant apoC-I content may serve as an early marker for coronary artery disease risk. (PMID: 12231568)
- TR4 regulates apolipoprotein E, C-I, and C-II gene expression. (PMID: 12954636)
- ApoC-I potently inhibits LPL-mediated triglyceride lipolysis. (PMID: 15576844)
- Liver-specific ApoC-I expression causes hypertriglyceridemia. (PMID: 16478678)
- Endogenous ApoC-I increases hyperlipidemia by stimulating VLDL production and inhibiting LPL. (PMID: 16537968)
- ApoC-I knockout mice show increased hepatic cholesteryl esters, triglycerides, and biliary cholesterol. (PMID: 17053273)
- Systemic ApoC-I increases atherosclerosis, likely via hyperlipidemia. (PMID: 17320883)
- ApoC-I binds free fatty acids, reducing blood FFA uptake. (PMID: 17339654)
- ApoC-I is involved in LPS-induced atherosclerosis via increased inflammatory response. (PMID: 17967778)
- ApoC-I inhibits scavenger receptor BI-mediated HDL cholesterol uptake and influences HDL plasma levels and size. (PMID: 18992221)
Database Links
Protein Families
Apolipoprotein C1 family
Subcellular Location
Secreted.
Tissue Specificity
Adult and fetal liver.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
