Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

Bcl2 suppresses apoptosis through multiple pathways:

  • Mitochondrial Regulation: Controls outer mitochondrial membrane permeability to prevent cytochrome c release, blocking caspase activation .

  • Caspase Inhibition: Binds apoptotic protease-activating factor 1 (APAF-1) to inhibit caspase-9 and caspase-3 activation .

  • Autophagy Modulation: Interacts with BECN1 and AMBRA1 to inhibit autophagy under nutrient-rich conditions .

  • Inflammasome Suppression: Attenuates NLRP1 inflammasome activation, reducing caspase-1-dependent IL-1β release .

Regulatory Mechanisms:

  • Phosphorylation at Ser-70 by PKC or ERKs enhances anti-apoptotic activity .

  • Dephosphorylation by PP2A reduces activity .

Research Applications

Recombinant Bcl2 is widely used to investigate apoptosis in diverse contexts:

ApplicationKey FindingsReference
HematopoiesisTransgenic mice overexpressing Bcl2 show expanded lymphoid/myeloid populations and altered T-cell development .
Cancer BiologyElevated Bcl2 in hepatocellular carcinoma (HCC) promotes chemoresistance by blocking Fas/FasL pathways .
Autophagy StudiesBcl2-BECN1 interaction inhibits autophagy, a mechanism explored in nutrient-stress models .
Therapeutic DevelopmentBH3-mimetics (e.g., ABT-199) target Bcl2 to restore apoptosis in B-cell malignancies .

In Vitro Functional Data

  • Refolded Bcl2(1–203) retains anti-apoptotic activity, protecting T hybridoma cells from glucocorticoid-induced apoptosis .

  • Limited proteolysis reveals a protease-sensitive linker between BH3 and BH4 domains, suggesting a two-domain structure .

In Vivo Phenotypes

  • Lymphoid Expansion: Vav-Bcl2 transgenic mice exhibit 5-fold increases in mature B cells and CD4+/CD8+ T cells .

  • Platelet Reduction: Bcl2 overexpression halves platelet counts, implicating Bcl2-Bim interactions in megakaryocyte regulation .

  • Cancer Predisposition: Prolonged B-cell survival in Bcl2-transgenic mice increases lymphoma risk .

Production and Quality Control

Recombinant Bcl2 is produced via affinity chromatography and validated for consistency:

  • Storage: Stable for 6–12 months at -20°C/-80°C in liquid or lyophilized form .

  • Functional Validation: Confirmed through apoptosis rescue assays and mitochondrial binding studies .

Clinical and Therapeutic Relevance

  • Cancer: High Bcl2 expression correlates with poor prognosis in follicular lymphoma and HCC .

  • Therapeutic Targets: BH3-mimetics like venetoclax (ABT-199) inhibit Bcl2, showing efficacy in clinical trials for chronic lymphocytic leukemia .

  • Inflammatory Diseases: Extracellular Bcl2 reduces tissue damage in murine ischemia-reperfusion models by modulating inflammation .

Future Directions

  • Isoform-Specific Roles: The truncated Bcl2β isoform (lacking the transmembrane domain) remains poorly characterized despite potential functional divergence .

  • Combination Therapies: Pairing BH3-mimetics with autophagy inhibitors may overcome resistance in Bcl2-driven cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bcl2; Bcl-2; Apoptosis regulator Bcl-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA VHREMAARTSPLRPLVATAGPALSPVPPCVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Uniprot No.

Target Background

Function
Bcl-2 is an apoptosis regulator that suppresses apoptosis in various cell types, including factor-dependent lymphohematopoietic and neural cells. Its mechanism involves regulating mitochondrial membrane permeability and interacting with caspases in a feedback loop. Bcl-2 inhibits caspase activity by preventing cytochrome c release from mitochondria and/or binding to apoptosis-activating factor 1 (APAF-1). Additionally, it inhibits autophagy by interacting with BECN1 and AMBRA1 under non-starvation conditions. Bcl-2 may also play a role in attenuating inflammation by suppressing NLRP1 inflammasome activation, thereby reducing caspase-1 activation and IL-1β release.
Gene References Into Functions
  1. Disruption of the beclin 1-BCL2 complex enhances autophagy, potentially improving healthspan and longevity. PMID: 29849149
  2. Age-related apoptosis in auditory cortex neurons is linked to miR-34a/Bcl-2 signaling, suggesting a mechanism for age-related hearing loss. PMID: 28817812
  3. MiR-146a inhibits proliferation and induces apoptosis in murine osteoblasts by regulating Bcl2. PMID: 28975995
  4. Ru(II) complexes induce S-180 cell apoptosis via the mitochondrial pathway, involving Bcl-2 inhibition and p53/Bax activation. PMID: 28795366
  5. SPK2 interacts with Bcl2, activating autophagy and protecting neurons against ischemic injury. PMID: 28682313
  6. Cell survival depends on the quantitative contribution of multiple anti-apoptotic proteins (BCL2, Mcl1, and BCL2A1). PMID: 28362427
  7. Bcl-2 expression is reduced in the cochlea and auditory cortex during aging, correlating with hearing loss and hair cell loss. PMID: 27925611
  8. Bcl2 is an autophagy-related target of miR-449a. PMID: 27351886
  9. BclxL, Bcl-2, BAD, and BID regulate migration of triple-negative breast cancer cells stimulated with cl-CD95L. PMID: 27367565
  10. Ethanol induces autophagy-mediated heart toxicity through the ROS-JNK-Bcl-2 pathway. PMID: 28369910
  11. High BCL-2 levels contribute to glucocorticoid resistance in Th17 cells in inflammatory conditions like asthma. PMID: 26752231
  12. Estrogen protects skeletal myoblasts from H2O2-induced apoptosis by modulating p53, FoxO, and their target genes (Bcl-2, Bim, Puma, PERP, and MDM2). PMID: 27249370
  13. Bcl-2 expression impacts the mineralogical content of tooth enamel crystals. PMID: 28610838
  14. CARP protects against hypoxia-reperfusion induced cardiomyocyte apoptosis, potentially by increasing Bcl2 gene expression. PMID: 27713078
  15. Crebbp deletion impairs B-cell development and cooperates with Bcl2 overexpression in promoting B-cell lymphoma. PMID: 28288979
  16. BCL2 binding to BIM is crucial for the survival of noncycling NK cells. PMID: 28057804
  17. LIGHT signaling with IFN-gamma induces beta-cell apoptosis via an NF-kappaB/Bcl2-dependent mitochondrial pathway. PMID: 27241100
  18. Bcl-2 is highly expressed in tubulointerstitial infiltrates in NZB/NZW lupus-prone mice. PMID: 27159593
  19. Bcell lymphoma 2 (an antiapoptotic gene) is a target of mmumiR96. PMID: 28259902
  20. Ha-Ras and Bcl-2 suppress terminal differentiation and maintain stem cell-like features in epidermal keratinocytes. PMID: 27655119
  21. MTA1 upregulation during neuronal ischemic injury interacts with ERalpha and BCL2 pathways. PMID: 26728277
  22. SKPs show higher Bcl-2, Nrf2, and HO-1 protein levels than FBs, suggesting a role in resisting UVB-induced apoptosis. PMID: 27635399
  23. Bcl-2 is an essential regulator of doublecortin-expressing immature neuron survival. PMID: 26266948
  24. BCL-2 deletion does not affect platelet production or lifespan. PMID: 25880088
  25. BCL2 family expression changes are independent of STAT3 signaling but may result from STAT5 derepression. PMID: 26045049
  26. The Bcl-2-caspase-9 pathway is activated in the testis of asthmatic mice. PMID: 26938720
  27. Endothelial Bcl-2 expression plays a role in postnatal retinal vascularization and choroidal neovascularization. PMID: 26444547
  28. BCL2, FGF-R1, and HSP70 protein expression was studied after magnetic thermoablative tumor treatment in a breast cancer model. PMID: 25792827
  29. miR-181c downregulation increases Bcl-2 levels, protecting mitochondria from TNF-alpha-induced apoptosis. PMID: 25898913
  30. Shh inhibits cell death by activating Bcl-2 via a GRP78-dependent pathway. PMID: 25961032
  31. NF-kappaB p65 knockdown inhibits Lewis tumor growth by inducing apoptosis and downregulating Bcl-2. PMID: 26178579
  32. Targeting the BCL-2 family is a potential therapeutic strategy for diseases with dysregulated apoptosis. PMID: 26344567
  33. AU-rich element deletion in the Bcl2 3'UTR reduces protein expression and B cell survival. PMID: 25680182
  34. Anti-dsDNA autoantibodies may contribute to lupus nephritis by upregulating ERK activation and Bcl-2 production in mesangial cells. PMID: 26189065
  35. BCL-2 overexpression enhances XBP-1 splicing, suggesting a role in IRE1alpha regulation. PMID: 26319553
  36. Bcl-2 counteracts palmitate-induced beta-cell death by maintaining mitochondrial integrity and augmenting NF-kappaB activity. PMID: 25266628
  37. BCL2-overexpressing B cells require multiple germinal center transits before developmental arrest and constitutive AID activity in follicular lymphoma. PMID: 25384217
  38. ZFP36L1 mediates degradation of anti-apoptotic BCL2 mRNA in malignant B-cells. PMID: 25014217
  39. MPT64 inhibits RAW264.7 macrophage apoptosis through the NF-kappaB-miRNA21-Bcl-2 pathway. PMID: 25000291
  40. Melanoma cells overexpress Bcl-2 and undergo senescence under hypoxic conditions for survival. PMID: 24966955
  41. Bcl2 deficiency activates FoxO1 and FoxO3a, increasing bone mass and osteoblast apoptosis. PMID: 24466179
  42. Bcl-2 inhibition stimulates NSC proliferation, suggesting a role in neuronal differentiation. PMID: 25470948
  43. SigmaR1 regulates ER stress in retinal Muller cells, and its neuroprotective role may involve BCL2. PMID: 24469320
  44. IL-15 does not affect Bcl-2 protein levels. PMID: 24825007
  45. TREM-1 induces Bcl-2 and prolongs macrophage survival. PMID: 24711453
  46. In pancreatic beta-cells, miR-34a upregulation promotes apoptosis and Bcl2 downregulation upon palmitate exposure. PMID: 24829923
  47. Bcl-2 is highly expressed in undifferentiated embryonic stem cells, contributing to their resistance to cell death. PMID: 24293136
  48. Bcl-2 upregulation after traumatic brain injury contributes to neuronal cell death. PMID: 25057207
  49. Myotubes with low Bcl-2 expression are susceptible to apoptosis. PMID: 24129924
  50. Bcl2 mutations in resistant lymphoma cells impede ABT-199 binding, suppressing mitochondrial apoptosis. PMID: 24786774
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in a variety of tissues.

Q&A

What is the molecular function of Bcl-2 in apoptosis regulation?

Bcl-2 (B-cell lymphoma 2) is a 25-26 kDa protein that functions as a key negative regulator of apoptosis. Mechanistically, Bcl-2 inhibits cell death through multiple pathways: it prevents the release of cytochrome c from mitochondria and/or binds to the apoptosis-activating factor (APAF-1), thereby inhibiting caspase activation within a feedback loop system . Additionally, Bcl-2 regulates cell death by controlling mitochondrial membrane permeability, which is crucial for maintaining cellular homeostasis . The protein also acts as an inhibitor of autophagy by interacting with BECN1 and AMBRA1 during non-starvation conditions . Recent evidence suggests Bcl-2 may attenuate inflammation through impairing NLRP1-inflammasome activation, consequently inhibiting CASP1 activation and IL1B release .

How does recombinant Bcl-2 differ from native Bcl-2 in experimental contexts?

Recombinant mouse Bcl-2 proteins are engineered to maintain functional properties of the native protein while facilitating detection and purification through tags such as His-tags . While the core functional domains remain preserved, researchers should note several important distinctions:

  • Post-translational modifications: Recombinant Bcl-2 expressed in bacterial systems lacks mammalian post-translational modifications, particularly phosphorylation events which significantly alter function. Phosphorylation at Serine70 (S70) enhances Bcl-2's binding affinity to proapoptotic members like Bim and Bak, increasing cell viability and chemotherapeutic resistance .

  • Protein folding and conformation: E. coli-produced proteins may have subtle conformational differences that could affect binding affinity to partner proteins.

  • Tag interference: The His-tag, while useful for purification, may occasionally interfere with protein-protein interactions in certain experimental contexts, requiring validation against untagged controls.

  • Solubility characteristics: Recombinant proteins may have different solubility properties compared to native Bcl-2, potentially requiring optimization of buffer conditions for specific applications.

When designing experiments, these differences should be considered, and appropriate controls should be implemented to ensure experimental validity.

What are the optimal conditions for storing and handling recombinant mouse Bcl-2 protein?

For maintaining recombinant mouse Bcl-2 protein stability and activity, implementation of proper storage and handling protocols is critical:

Storage Recommendations:

  • Store lyophilized protein at -20°C for longer-term storage

  • After reconstitution, aliquot and store at -80°C to avoid freeze-thaw cycles

  • Limit freeze-thaw cycles to a maximum of 3-5 to preserve protein integrity

  • For working solutions, store at 4°C for no longer than 2-4 weeks

Buffer Optimization:

  • For most applications, reconstitute in phosphate-buffered saline (PBS) with 0.1% carrier protein (BSA)

  • Include reducing agents (e.g., 1mM DTT) in buffers to maintain native conformation

  • For enhanced stability, consider adding 10% glycerol to storage buffers

  • pH should be maintained between 7.2-7.6 for optimal stability

Handling Precautions:

  • Always work with the protein on ice when thawed

  • Centrifuge protein solutions briefly before opening to collect material at the bottom

  • Use low-binding microcentrifuge tubes to prevent protein adherence to tube walls

  • Avoid vigorous vortexing which can lead to protein denaturation; instead, mix by gentle inversion

Following these guidelines will maximize protein stability and functional activity in experimental applications.

What validation methods should be used to confirm recombinant Bcl-2 activity?

Comprehensive validation of recombinant Bcl-2 activity requires multiple complementary approaches:

Functional Assays:

  • Apoptosis inhibition assay: Measure the ability of recombinant Bcl-2 to inhibit apoptosis in cell systems, particularly in factor-dependent lymphohematopoietic cells or neural cells . Quantify via flow cytometry with Annexin V/PI staining or caspase activity assays.

  • Cytochrome c release assay: Assess the capacity of recombinant Bcl-2 to prevent cytochrome c release from isolated mitochondria exposed to apoptotic stimuli . Monitor cytochrome c levels in mitochondrial and cytosolic fractions via Western blot.

  • Caspase inhibition assay: Determine if the recombinant protein inhibits caspase activity, particularly caspase-3 and caspase-9, using fluorogenic or colorimetric substrates .

Binding Assays:

  • Co-immunoprecipitation: Confirm binding to pro-apoptotic Bcl-2 family members (Bax, Bak) and other interaction partners like APAF-1 and BECN1 .

  • Surface Plasmon Resonance (SPR): Quantitatively measure binding kinetics and affinity constants of Bcl-2 with its interaction partners.

  • Microscale Thermophoresis (MST): Assess protein-protein interactions with minimal sample consumption.

Structural Validation:

  • Circular Dichroism (CD) spectroscopy: Confirm proper protein folding by analyzing secondary structure.

  • Limited proteolysis: Compare digestion patterns with native Bcl-2 to verify structural integrity.

Implementing these validation approaches ensures that the recombinant protein maintains its physiological activities and provides a reliable reagent for experimental applications.

What are the appropriate applications for recombinant mouse Bcl-2 in cell-based assays?

Recombinant mouse Bcl-2 protein serves as a versatile tool in numerous cell-based experimental systems:

Cellular Uptake Studies:

  • Protein transduction methods can be employed to introduce recombinant Bcl-2 into cells to study immediate effects on apoptotic pathways

  • Cell-penetrating peptide-conjugated Bcl-2 can be used to enhance cellular uptake

  • Comparative analysis of intracellular delivery methods should be conducted to optimize experimental conditions

Functional Studies:

  • Apoptosis resistance models: Adding recombinant Bcl-2 to cultured cells can help establish models of apoptosis resistance for studying chemotherapeutic resistance mechanisms .

  • Mitochondrial permeability studies: Recombinant protein can be used in isolated mitochondria to study direct effects on membrane permeability transition .

  • BH3 mimetic drug screening: The protein provides a valuable tool for screening the efficacy of BH3 mimetic compounds in disrupting Bcl-2's anti-apoptotic function .

  • Autophagy regulation investigations: Recombinant Bcl-2 can be used to study its interactions with BECN1 and AMBRA1 in modulating autophagy pathways .

Competitive Binding Assays:

  • Utilizing labeled recombinant Bcl-2 to identify compounds that disrupt protein-protein interactions

  • Developing high-throughput screening platforms for drug discovery targeting Bcl-2 interactions

  • Investigation of binding dynamics in different cellular compartments (cytosolic versus mitochondrial)

For optimal results, researchers should validate the functional activity of their recombinant protein batch and establish appropriate controls for each specific cell-based application.

How can recombinant Bcl-2 be used to study its role in modulating the tumor microenvironment?

Recent research indicates that Bcl-2 inhibitors can modify the tumor microenvironment to make it more hospitable to immune cell infiltration . Recombinant Bcl-2 provides a valuable tool for dissecting these interactions:

Experimental Approaches:

  • Co-culture systems: Recombinant Bcl-2 can be utilized in co-culture models of tumor cells with stromal and immune components to examine paracrine effects. This allows researchers to study how Bcl-2-mediated signaling from tumor cells affects surrounding non-malignant cells.

  • 3D organoid models: Incorporating recombinant Bcl-2 into tumor organoid cultures helps simulate the native tumor microenvironment more accurately than 2D cultures. Researchers can then assess how Bcl-2 levels influence organoid formation, growth dynamics, and response to therapeutic agents.

  • Immune cell activation assays: By exposing tumor-infiltrating lymphocytes or macrophages to recombinant Bcl-2, researchers can quantify changes in immune cell activation markers, cytokine production, and effector functions.

Research Applications:

  • T-cell exhaustion studies: Investigating whether recombinant Bcl-2 contributes to T-cell exhaustion phenotypes characterized by upregulation of inhibitory receptors like PD-1, LAG-3, and TIM-3.

  • Myeloid-derived suppressor cell (MDSC) induction: Evaluating if Bcl-2 influences the recruitment or function of MDSCs, which are known to create immunosuppressive tumor microenvironments.

  • Angiogenesis modulation: Determining whether Bcl-2 affects endothelial cell function and tumor vascularization, which significantly impacts tumor progression and therapeutic delivery.

The methodological approach should include appropriate controls such as heat-inactivated Bcl-2 and other Bcl-2 family members to establish specificity of observed effects.

What are the best methods for studying Bcl-2 phosphorylation states and their functional consequences?

Bcl-2 phosphorylation, particularly at Serine70 (S70), significantly enhances its binding affinity to proapoptotic members like Bim and Bak, increasing cell viability and chemotherapeutic resistance . Studying these modifications requires specialized approaches:

Detection and Quantification Methods:

  • Phospho-specific antibodies: Employ highly specific antibodies targeting phosphorylated residues (particularly S70, S87, and T69) for Western blotting, immunoprecipitation, and immunofluorescence microscopy.

  • Phos-tag SDS-PAGE: This specialized gel system retards the migration of phosphorylated proteins, allowing clear separation of different phosphorylation states without requiring phospho-specific antibodies.

  • Mass spectrometry techniques:

    • Targeted LC-MS/MS for identification of specific phosphorylation sites

    • SILAC labeling for quantitative comparison of phosphorylation levels

    • Phosphopeptide enrichment strategies using TiO₂ or IMAC prior to MS analysis

Functional Analysis Approaches:

  • Site-directed mutagenesis: Create phospho-mimetic (S→D/E) and phospho-deficient (S→A) mutants of recombinant Bcl-2 to study the functional consequences of specific phosphorylation events. Compare these mutants in:

    • Binding assays with pro-apoptotic partners

    • Mitochondrial localization studies

    • Apoptosis resistance assays

  • Kinase inhibitor studies: Use specific inhibitors of Bcl-2-targeting kinases (e.g., JNK, ERK, PKC) to modulate phosphorylation states in experimental systems.

  • In vitro kinase assays: Recombinant Bcl-2 can serve as a substrate for purified kinases to establish direct phosphorylation events and kinetics.

Research Applications Table:

Phosphorylation SitePrimary KinaseFunctional ConsequenceDetection MethodExperimental Model
Serine70 (S70)PKC, ERK1/2↑ Binding to Bim/BakPhospho-S70 AbChemoresistant tumor cells
Threonine69 (T69)JNK↓ Anti-apoptotic functionPhos-tag SDS-PAGEStress-induced apoptosis
Serine87 (S87)PKAAltered mitochondrial localizationLC-MS/MSIschemia-reperfusion models

By implementing these methodologies, researchers can gain deeper insights into how post-translational modifications regulate Bcl-2's anti-apoptotic functions.

How can recombinant Bcl-2 be utilized in high-throughput drug screening platforms?

Recombinant Bcl-2 serves as an essential tool for developing and implementing high-throughput screening (HTS) methods to identify novel therapeutic compounds:

Binding Disruption Assays:

  • Fluorescence Polarization (FP) Assays: This technique uses fluorescently-labeled BH3 peptides (from pro-apoptotic proteins like BAD, BIM, or NOXA) and measures their interaction with recombinant Bcl-2. Compounds that disrupt this interaction cause a decrease in polarization signal .

  • Time-Resolved Fluorescence Resonance Energy Transfer (TR-FRET): Using lanthanide-labeled Bcl-2 and compatible fluorophore-labeled BH3 peptides allows for sensitive detection of binding disruption with minimal interference from compound fluorescence.

  • AlphaScreen Technology: This bead-based proximity assay can detect Bcl-2 interactions with target proteins and is amenable to ultra-high-throughput screening formats.

Functional HTS Platforms:

  • Reconstituted systems: Recombinant Bcl-2 can be incorporated into artificial membrane systems with other components of the apoptotic machinery to create biochemical assays measuring cytochrome c release or membrane permeabilization .

  • Cell-based reporter assays: Engineered cell lines expressing recombinant Bcl-2 alongside luminescent or fluorescent reporters linked to apoptotic pathways provide cellular context for compound screening.

  • Thermal shift assays: Differential scanning fluorimetry can identify compounds that bind directly to recombinant Bcl-2 by altering its thermal stability profile.

Methodological Considerations:

  • Assay validation parameters:

    • Z' factor should exceed 0.5 for robust assay performance

    • Signal-to-background ratio >10:1 is desirable

    • Evaluate DMSO tolerance (typically up to 1% final concentration)

    • Include positive controls such as known BH3 mimetics (e.g., ABT-199)

  • Counter-screening strategy:

    • Screen against other Bcl-2 family members (Bcl-XL, Mcl-1) to assess selectivity

    • Include orthogonal secondary assays to confirm mechanism of action

    • Employ cell-based viability assays to confirm on-target cellular activity

By implementing these screening platforms with recombinant Bcl-2, researchers can identify novel compounds that specifically target Bcl-2-dependent anti-apoptotic mechanisms with potential therapeutic applications.

How does mouse Bcl-2 compare to human Bcl-2 in research contexts?

When utilizing mouse models to study Bcl-2 biology with translational relevance to human diseases, understanding the similarities and differences between species is crucial:

Sequence and Structural Homology:
Mouse and human Bcl-2 proteins share approximately 90% amino acid sequence identity with particularly high conservation in the functional BH domains. Critical residues involved in BH3 domain binding and protein-protein interactions are generally preserved across species, allowing mouse models to provide valuable insights into human Bcl-2 biology .

Functional Conservation and Divergence:

  • Conserved functions:

    • Both mouse and human Bcl-2 inhibit mitochondrial outer membrane permeabilization

    • Both interact with key pro-apoptotic proteins (Bax, Bak, Bim)

    • Both demonstrate protection against a variety of apoptotic stimuli

  • Subtle differences:

    • Binding affinities for BH3-only proteins may vary slightly between species

    • Post-translational modification sites show some divergence

    • Species-specific regulatory mechanisms may influence expression patterns

Experimental Considerations Table:

Research ApplicationSpecies CompatibilityLimitationsMethodological Recommendations
Basic apoptotic mechanismsHigh transferabilityMinimal concernsEither species appropriate
BH3 mimetic drug developmentGenerally transferableSome binding affinity differencesValidate with both species proteins
Post-translational modificationsModerate transferabilityDifferent phosphorylation patternsSpecies-specific validation required
In vivo tumor modelsContext-dependentTumor microenvironment differencesUse mouse Bcl-2 for mouse models
Translational biomarkersRequires careful validationExpression patterns may differAlways validate in human samples

In transgenic mouse models overexpressing Bcl-2, cardioprotective effects against ischemia-reperfusion injury have been demonstrated, with significantly improved functional recovery of hearts when perfused as Langendorff preparations and a threefold decrease in lactate dehydrogenase (LDH) release . These findings have translational relevance to human cardiovascular disease, suggesting conservation of Bcl-2's protective functions across species.

What are the methodological approaches for studying Bcl-2's role in chemoresistance mechanisms?

Bcl-2 overexpression contributes significantly to chemoresistance in multiple cancer types . Recombinant Bcl-2 provides valuable tools for investigating these mechanisms:

In Vitro Resistance Models:

  • Isogenic cell line panels: Generate matched sensitive/resistant cell lines through:

    • Stable transfection with recombinant Bcl-2 expression constructs

    • CRISPR/Cas9-mediated Bcl-2 upregulation

    • Selection of resistant subpopulations after drug exposure

    These systems allow direct comparison of Bcl-2-mediated resistance mechanisms while controlling for genetic background.

  • 3D spheroid resistance assays: Recombinant Bcl-2-expressing cells often display different resistance profiles in 3D culture compared to 2D, better reflecting in vivo tumor behavior.

  • Co-culture resistance models: Studying how Bcl-2-overexpressing cancer cells influence chemoresistance in neighboring cells through paracrine mechanisms.

Mechanistic Investigation Approaches:

  • Apoptotic threshold determination: Quantifying how much additional pro-apoptotic signaling is required to overcome Bcl-2-mediated protection using BH3 profiling techniques.

  • Mitochondrial priming status: Assessing the proximity to the apoptotic threshold in Bcl-2-overexpressing cells compared to controls.

  • Combination therapy screening: Identifying compounds that specifically sensitize Bcl-2-overexpressing cells to standard chemotherapeutics.

Clinical Correlation Methods:

  • Patient-derived xenograft (PDX) models: Correlating Bcl-2 expression levels with treatment responses in PDX models provides translational insights.

  • Ex vivo drug sensitivity testing: Exposing patient samples to chemotherapeutics with or without Bcl-2 inhibitors can predict potential clinical responses.

  • Biomarker development: Using recombinant Bcl-2 as standards for developing quantitative assays to measure Bcl-2 levels in patient samples.

What are the latest methodologies for targeting Bcl-2 phosphorylation as a therapeutic strategy?

Phosphorylation of Bcl-2, particularly at Serine70 (S70), enhances its anti-apoptotic function by increasing binding affinity to proapoptotic members, contributing to chemoresistance . Developing therapeutic approaches targeting these modifications requires sophisticated methodology:

Target Validation Approaches:

  • Phosphosite-specific inhibition strategies:

    • Development of peptide inhibitors that specifically bind phosphorylated Bcl-2

    • Small molecules designed to recognize and bind phosphorylated epitopes

    • Allosteric inhibitors that destabilize phosphorylated conformations

  • Kinase targeting approaches:

    • Selective inhibition of kinases responsible for Bcl-2 phosphorylation (PKC, ERK1/2, JNK)

    • Dual kinase/Bcl-2 inhibitors for synergistic effects

    • Phosphatase activation to promote dephosphorylation of Bcl-2

Experimental Models for Evaluation:

  • Phosphomimetic Bcl-2 expressing cell lines: Cell lines expressing S70D or S70E Bcl-2 mutants to model constitutively phosphorylated states can be used to identify compounds that specifically overcome phosphorylation-enhanced anti-apoptotic function.

  • Patient-derived models with hyperphosphorylated Bcl-2: Samples from resistant tumors often display increased Bcl-2 phosphorylation and provide clinically relevant testing platforms.

  • In vivo models of induced phosphorylation: Models where Bcl-2 phosphorylation can be temporally controlled allow for testing intervention strategies at different disease stages.

Therapeutic Development Strategies:

  • Structure-guided design: Using crystal structures of phosphorylated Bcl-2 to design compounds that specifically recognize these states.

  • Combination approaches: Developing regimens that combine kinase inhibitors with BH3 mimetics for enhanced efficacy against resistant tumors.

  • Nanoparticle delivery systems: Targeted delivery of siRNAs or phosphatase-activating compounds specifically to tumor cells with hyperphosphorylated Bcl-2.

Monitoring Response Metrics:

  • Phospho-Bcl-2/total Bcl-2 ratio: Using phospho-specific antibodies to monitor treatment efficacy.

  • BH3 profiling before and after treatment: Assessing changes in apoptotic priming and dependency on specific anti-apoptotic proteins.

  • Phosphoproteomics: Broader analysis of phosphorylation changes in the apoptotic machinery to identify compensatory mechanisms.

Through these methodological approaches, researchers can develop more effective strategies targeting the enhanced anti-apoptotic function conferred by Bcl-2 phosphorylation, potentially overcoming resistance to current Bcl-2 inhibitors.

How can researchers address inconsistencies in Bcl-2 experimental results across different model systems?

Researchers studying Bcl-2 frequently encounter variability in results across different experimental systems. These inconsistencies can be systematically addressed through methodological refinements:

Common Sources of Variability:

  • Expression level differences: Recombinant Bcl-2 expression levels may vary dramatically between systems, affecting experimental outcomes. Quantitative Western blotting with standard curves should be employed to precisely measure protein levels across experimental conditions.

  • Post-translational modification heterogeneity: Different cell types process Bcl-2 differently, resulting in varied phosphorylation patterns that alter function . Phospho-specific antibodies should be used to characterize modification status.

  • Binding partner availability: The cellular repertoire of pro-apoptotic binding partners varies between cell types, affecting apparent Bcl-2 function. BH3 profiling can characterize the specific dependencies in each system.

  • Subcellular localization differences: Bcl-2 function depends on proper localization, which may vary between systems. Fractionation studies should verify comparable distribution patterns.

Standardization Approaches:

  • Reference standards: Establish universal recombinant Bcl-2 reference standards with defined activity metrics.

  • Normalized assay systems: Develop assays that account for differences in expression levels and binding partner availability.

  • Multi-parameter analysis: Simultaneously measure multiple aspects of Bcl-2 function to obtain a comprehensive functional profile.

Troubleshooting Methodology:

Common ProblemPotential CausesDiagnostic ApproachSolution Strategy
Lack of anti-apoptotic effectLow expression levels; Improper localization; Competition from endogenous proteinsQuantitative Western blot; Subcellular fractionation; Binding partner analysisTitrate expression levels; Add localization signal; Knockdown endogenous competitors
Variable response to BH3 mimeticsDifferent phosphorylation states; Varied binding partner profilesPhospho-status analysis; BH3 profilingUse phosphatase treatment; Normalize to BH3 profile
Contradictory results between in vitro and cellular systemsMissing cofactors; Membrane context absenceCompare purified mitochondria to recombinant systems; Add specific lipidsReconstitute with complete binding partner set; Use liposomal systems
Species-specific differencesSequence variations; Post-translational modification differencesCross-species comparative analysisUse species-matched systems throughout study

By implementing these systematic approaches to standardization and troubleshooting, researchers can significantly improve consistency and reproducibility in Bcl-2 research across different model systems.

What are the critical controls needed when working with recombinant Bcl-2 in functional assays?

Rigorous control implementation is essential for generating reliable and reproducible data with recombinant Bcl-2 proteins:

Positive and Negative Controls:

  • Activity controls:

    • Positive: Known active BH3-only proteins (e.g., BIM BH3 peptides) that reliably induce cytochrome c release or apoptosis

    • Negative: Heat-inactivated Bcl-2 protein that maintains structure but loses function

    • Benchmark: Commercial recombinant Bcl-2 with defined activity metrics

  • Specificity controls:

    • Other anti-apoptotic family members (Bcl-xL, Mcl-1) to distinguish Bcl-2-specific effects

    • Bcl-2 mutants with single amino acid changes in the binding groove that abolish interactions with pro-apoptotic partners

    • Scrambled or non-functional BH3 peptides in binding assays

Functional Validation Controls:

  • For apoptosis assays:

    • Include both early (phosphatidylserine externalization) and late (membrane permeability) apoptotic markers

    • Measure multiple caspase activities (initiator and executioner)

    • Include pan-caspase inhibitors (z-VAD-fmk) to confirm apoptotic mechanism

  • For binding assays:

    • Titration series to establish dose-dependence

    • Competition assays with unlabeled proteins to confirm specificity

    • Multiple detection methods (e.g., both fluorescence polarization and AlphaScreen)

Technical Controls:

  • Buffer controls: Ensure that buffer components alone do not affect experimental outcomes; include vehicle controls matching the highest concentration used.

  • Tag-only controls: Express and purify tag-only proteins (e.g., His-tag peptide) to control for tag-specific effects.

  • Endotoxin testing: For cell-based assays, confirm that recombinant protein preparations are endotoxin-free to avoid inflammatory activation.

Biological Context Controls:

  • Cell line authentication: Regularly verify cell line identity and Bcl-2 family expression profiles.

  • Expression level normalization: When comparing different Bcl-2 variants, ensure equivalent expression levels through titration experiments.

  • Genetic knockout/knockdown validation: Confirm phenotypes in Bcl-2 null backgrounds with rescue experiments.

Implementation of these comprehensive controls ensures that observed effects are specifically attributable to recombinant Bcl-2 function rather than experimental artifacts or non-specific effects.

How can researchers address contradictory findings regarding Bcl-2's role beyond apoptosis regulation?

Beyond its canonical role in apoptosis regulation, Bcl-2 has been implicated in multiple cellular processes including autophagy, calcium handling, mitochondrial dynamics, and inflammation regulation . Contradictory findings in these non-canonical functions can be addressed through systematic methodological approaches:

Experimental Design Strategies:

  • Function-specific domain mapping:

    • Generate domain-deletion mutants to separate apoptotic from non-apoptotic functions

    • Create chimeric proteins swapping domains between Bcl-2 family members

    • Employ point mutations that selectively disrupt specific protein-protein interactions

  • Temporal control systems:

    • Use inducible expression systems to distinguish acute versus chronic effects of Bcl-2

    • Employ optogenetic tools for precise temporal control of Bcl-2 activity

    • Implement small-molecule regulated protein degradation systems (e.g., PROTAC)

  • Context-dependent analysis:

    • Systematically vary cell type, growth conditions, and stress stimuli

    • Perform experiments under both basal and stressed conditions

    • Consider cell cycle phase and metabolic state as variables

Resolving Contradictions Methodology:

  • For autophagy regulation contradictions:

    • Distinguish between autophagy initiation and flux effects

    • Measure Bcl-2:Beclin1 interactions under defined nutrient conditions

    • Assess autophagy with multiple independent markers (LC3, p62, WIPI)

  • For calcium homeostasis contradictions:

    • Separately analyze ER and mitochondrial calcium pools

    • Distinguish between acute and chronic Bcl-2 effects on calcium

    • Consider compensatory changes in other calcium-regulating proteins

  • For inflammatory regulation discrepancies:

    • Differentiate between direct Bcl-2 effects and secondary consequences of apoptosis inhibition

    • Analyze cell-type specific inflammasome components

    • Control for differences in cell death modes (apoptosis vs. pyroptosis vs. necroptosis)

Comprehensive Analysis Framework:

A multi-parameter approach integrating multiple techniques can help resolve contradictory findings:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Perform pathway enrichment analysis to identify consistent patterns

    • Use network analysis to distinguish direct from indirect effects

  • Systems biology modeling:

    • Develop mathematical models incorporating known Bcl-2 interactions

    • Simulate the effects of experimental perturbations

    • Identify parameter sensitivities that might explain contradictory results

  • In vivo validation:

    • Use tissue-specific and inducible Bcl-2 transgenic/knockout models

    • Employ multiple independent approaches to measure the same endpoint

    • Correlate findings across different physiological and pathological contexts

By implementing these systematic approaches, researchers can more effectively resolve contradictions and develop a more unified understanding of Bcl-2's diverse functions beyond apoptosis regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.