Recombinant Mouse Aquaporin-11 (Aqp11)

Shipped with Ice Packs
In Stock

Description

Kidney Function

  • AQP11 is highly expressed in proximal tubule (PT) cells, where it mitigates glucose-induced oxidative stress by reducing reactive oxygen species (ROS) .

  • Mechanism:

    • Maintains ER homeostasis by regulating water flux across ER membranes .

    • Loss-of-function mutations (e.g., Cys227Ser) disrupt oligomerization, triggering ER stress, mitochondrial injury, and apoptosis .

Liver Homeostasis

  • Liver-specific AQP11 knockout (KO) mice develop vacuolar ER degeneration upon amino acid refeeding, linked to disrupted RER permeability and glutathione depletion .

  • Metabolic Impact: AQP11 deficiency reduces hepatic glucose levels during metabolic stress .

Brain Expression

  • Localized in choroid plexus epithelium and brain capillary endothelium, suggesting roles in cerebrospinal fluid dynamics and blood-brain barrier (BBB) function .

  • AQP11 KO mice show reduced AQP4 expression at the BBB, indicating cross-regulation between aquaporins .

Kidney-Specific Phenotypes

  • Homozygous Aqp11 Mutants: Develop severe PT injury, ER stress, and renal failure by 3 weeks of age .

  • Heterozygous Mutants: Exhibit increased susceptibility to glucose-induced oxidative stress, reversible by antioxidants (e.g., sulforaphane) or glucose transport inhibitors (e.g., phlorizin) .

Liver-Specific KO Models

  • Fasting-refeeding experiments in KO mice induce rapid RER vacuolization and ER stress markers (Grp78, GADD153) .

Table 2: Key Mutations and Phenotypic Outcomes

MutationModel SystemPhenotypeCitation
Cys227SerAqp11 KO micePT injury, ER stress, renal failure
Liver-specific KOConditional KORER vacuolization, metabolic dysfunction

Applications in Biomedical Research

  • Disease Modeling: Used to study polycystic kidney disease, diabetic nephropathy, and ER stress-related disorders .

  • Therapeutic Testing: Evaluates antioxidants and SGLT inhibitors for protecting PT cells from glucose toxicity .

  • Structural Studies: Investigates the role of Cys227 in oligomerization and channel function .

Challenges and Future Directions

  • Functional Transport Properties: Conflicting data exist on AQP11’s ability to transport water or solutes .

  • Interorgan Cross-Talk: Mechanisms linking AQP11 dysfunction in kidneys, liver, and brain remain unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your request when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Aqp11; Aquaporin-11; AQP-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Aqp11
Target Protein Sequence
MSALLGLRPEVQDTCISLGLMLLFVLFVGLARVIARQQLHRPVVHAFVLEFLATFQLCCCTHELQVLSEQDSAHPTWTLTLIYFFSLVHGLTLVGTASNPCGVMMQMILGGMSPEMGAVRLLAQLVSALCSRYCISALWSLSLTKYHYDERILACRNPIHTDMSKAIIIEAICSFIFHSALLHFQEVRTKLRIHLLAALITFLAYAGGSLTGALFNPALALSLHFPCFDELFYKFFVVYWLAPSVGVLMMILMFSFFLPWLHNNQMTNKKE
Uniprot No.

Target Background

Function
Aquaporin-11 (AQP11) is a channel protein that facilitates the transport of water, glycerol, and hydrogen peroxide across cell or organelle membranes, ensuring intracellular homeostasis in various organs such as the liver, kidney, and brain. Under stress conditions, AQP11 participates in endoplasmic reticulum (ER) homeostasis by regulating redox homeostasis through the transport of hydrogen peroxide across the ER membrane. This, in turn, regulates oxidative stress through the NADPH oxidase 2 pathway. AQP11 plays a role in maintaining a suitable environment for translation and protein folding within the ER lumen. This is achieved by participating in the glycosylation processing of polycystic kidney disease 1 (PKD1), regulating PKD1 membrane trafficking, and preventing the accumulation of unfolded proteins in the ER. AQP11 contributes to proximal tubule function by regulating endosomal acidification. It may also play a role in postnatal kidney development.
Gene References Into Functions
  1. Our study indicates that AQP11 knockout mice develop cyst-like dilated proximal tubules without documented cysts at the time of death. PMID: 27582095
  2. Our findings suggest that autophagy plays a role in the development and maintenance of kidney cysts in AQP11 knockout mice. PMID: 27916883
  3. AQP11 was primarily expressed in the pia matter with limited expression in the capillary at early postnatal stages (P1-P14). PMID: 27258268
  4. We found that impaired glycosylation processing and aberrant membrane trafficking of PC-1 in AQP11 knockout mice might be a key mechanism underlying cystogenesis in these mice. PMID: 24854278
  5. Our research highlights the crucial role of AQP11 in preventing glucose-induced oxidative stress in proximal tubules. PMID: 23486012
  6. Our study demonstrates that deletion of AQP11 disrupts rough endoplasmic reticulum homeostasis and increases sensitivity to rough ER injury upon metabolic challenge with amino acids. PMID: 23275615
  7. Our findings suggest that mouse aquaporin 11 may be involved in slow but constant water movement across the membrane. PMID: 21251984
  8. AQP11 plays a significant role during salivary gland development. PMID: 20156259
  9. Immunohistochemistry of mouse testis across development revealed the first appearance of AQP11 coinciding with late-stage elongated spermatids. cDNA analysis confirmed the sequence, and Western blotting revealed additional forms. PMID: 19812234
  10. AQP11 is essential for proximal tubular function. PMID: 16107722
  11. These results provide valuable insights into the physiological roles of AQP11. PMID: 18606867
  12. A mutation causing a single amino acid substitution in aquaporin 11 leads to renal failure in sudden juvenile death syndrome mutant mice. PMID: 18701606

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, AQP11/AQP12 subfamily
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, perinuclear region.
Tissue Specificity
Highly expressed in the S1 proximal tubule segment,. Expressed in the testis, kidney, and liver. Weakly expressed in the heart, brain, and muscle. Highly expressed in the testis. Expressed in the proximal tubule of the cortex of 8-day-old mouse kidney. Ex

Q&A

What is the structural uniqueness of Aquaporin-11 compared to other aquaporins?

Aquaporin-11 (AQP11) represents a distinctive member of the aquaporin family with several unique structural features. Unlike conventional aquaporins, AQP11 contains divergent NPA (asparagine-proline-alanine) motifs that constitute the water channel pore. This structural difference led to initial questions about its water transport capacity .

The protein shares only about 20% homology with conventional aquaporins, placing it in a novel subfamily called "subcellular AQPs" along with AQP12 . This subfamily appears evolutionarily recent, as these proteins are found only in multicellular organisms and absent in monocellular organisms such as bacteria, yeasts, and protozoans .

When investigating AQP11's structure experimentally, researchers should consider using advanced structural biology techniques such as X-ray crystallography or cryo-electron microscopy to fully elucidate how its divergent NPA boxes affect the pore structure and selectivity filter components.

Does Aquaporin-11 function as a water channel despite its divergent NPA motifs?

Yes, despite initial questions due to its divergent NPA motifs, experimental evidence confirms that AQP11 does function as a water channel. Research using purified mouse AQP11 (mAQP11) expressed in Sf9 cells and reconstituted into liposomes demonstrated water channel activity. Water permeability measurements using stopped-flow techniques revealed a single water permeability (pf) of 1.72±0.03×10^-13 cm^3/s .

This finding is significant as it suggests that other members of the subcellular AQP subfamily with incompletely conserved NPA motifs may also function as water channels . For experimental validation, researchers should:

  • Express recombinant AQP11 in appropriate expression systems (Sf9 cells have been successfully used)

  • Purify the protein using appropriate detergents (Fos-choline 10 has proven effective)

  • Reconstitute purified protein into liposomes

  • Measure water permeability using stopped-flow techniques

This methodological approach allows for direct assessment of AQP11's water transport capability independent of cellular context.

What is the tissue-specific expression pattern of Aquaporin-11 in mice?

AQP11 exhibits a tissue-specific expression pattern that varies developmentally. In newborn mice, AQP11 mRNA is expressed primarily in the intestines, liver, and kidney, while expression in the testis is not observed until approximately three weeks after birth .

Within specific tissues, AQP11 shows distinct cellular localization patterns:

  • Kidney: Expressed intracellularly in proximal tubule cells

  • Intestines: Found in epithelial cells

  • Liver: Expressed in hepatocytes

  • Testis: Expressed in Sertoli cells, appearing after AQP8 and before AQP7 during development

For researchers studying AQP11 expression, comprehensive analysis should include both temporal (developmental stage) and spatial (tissue and cellular) dimensions. Recommended methodological approaches include:

  • qRT-PCR for quantitative mRNA expression analysis across tissues and developmental stages

  • Immunohistochemistry using validated antibodies (such as the affinity-purified RaTM50b antibody) for cellular and subcellular localization studies

  • In situ hybridization to confirm expression patterns at the mRNA level

How is Aquaporin-11 expression regulated during development and physiological stress?

AQP11 expression shows developmental regulation, particularly in tissues such as the testis where expression begins approximately three weeks after birth . This timing corresponds to specific developmental processes in testicular maturation.

Interestingly, unlike some other aquaporins, AQP11 expression appears stable during certain physiological stresses. Experiments involving dehydration and subsequent rehydration in adult mice showed no significant changes in AQP11 mRNA expression in the kidney cortex and jejunum . This suggests that AQP11 may serve constitutive rather than regulated functions in water homeostasis.

For researchers investigating AQP11 regulation, recommended approaches include:

  • Time-course expression analysis during development using quantitative methods

  • Promoter analysis to identify regulatory elements controlling tissue-specific expression

  • Examination of various physiological stresses (beyond dehydration) that might affect expression

  • Investigation of potential post-translational modifications that could regulate AQP11 activity or localization

What is the subcellular localization of Aquaporin-11 and how does it differ from classical aquaporins?

Unlike classical aquaporins that primarily localize to the plasma membrane, AQP11 exhibits predominantly intracellular localization. In proximal tubule cells of the kidney, AQP11 is found intracellularly rather than at the cell surface . This distinctive localization pattern contributes to its classification within the "subcellular AQPs" subfamily .

Transfection studies in CHO-K1 cells demonstrated that AQP11 localizes to intracellular organelles , further confirming its distinct trafficking pattern. This intracellular localization makes functional studies more challenging compared to plasma membrane aquaporins.

For researchers investigating AQP11 subcellular localization:

  • Use high-resolution confocal microscopy with organelle-specific markers to determine precise localization

  • Consider electron microscopy for ultrastructural localization

  • Perform subcellular fractionation followed by immunoblotting for biochemical confirmation

  • Create fluorescently-tagged AQP11 constructs for live cell imaging studies, though validation against native protein localization is essential

What experimental approaches are most effective for detecting Aquaporin-11 protein in tissue samples?

Given the intracellular localization and relatively low expression levels of AQP11 in some tissues, detection requires careful methodological consideration. Based on published studies, effective approaches include:

  • Antibody development and validation:

    • Production of polyclonal antibodies against specific epitopes, such as the C-terminal peptide (CLPWLHNNQMTNKKE) used to generate the RaTM50b antibody

    • Affinity purification of antibodies to improve specificity

    • Validation using knockout models as negative controls

  • Immunoblotting protocols:

    • Careful sample preparation to preserve protein integrity

    • Appropriate blocking and antibody dilutions

    • Use of positive and negative controls (tissue from knockout animals)

  • Immunohistochemistry considerations:

    • Fixation optimization to preserve epitope accessibility

    • Antigen retrieval methods if needed

    • Counterstaining to establish cellular context

    • Parallel staining of knockout tissue as negative control

  • Recombinant expression systems:

    • Expression in systems like Sf9 cells has been successful

    • Purification using appropriate detergents like Fos-choline 10

What are the phenotypic consequences of Aquaporin-11 knockout in mice?

Studies of AQP11 knockout mice have revealed severe phenotypes, highlighting the critical physiological importance of this protein:

  • Systemic knockout effects:

    • AQP11-null mice are born normally but die before weaning due to advanced renal failure

    • Growth defects observed in surviving mice

  • Kidney phenotype:

    • Development of polycystic kidneys

    • Cyst formation primarily in the proximal tubules

    • Progressive cyst development: vacuoles present in proximal tubules of newborn mice develop into multiple cysts by 3 weeks of age

    • Cysts eventually occupy the entire renal cortex

  • Other tissue effects:

    • Vacuole formation in hepatocytes and intestinal epithelial cells

    • Decreased cellularity in seminiferous tubules, though fertility is maintained

    • Normal appearance of thymus and brain

These findings indicate that AQP11 plays essential roles in cellular homeostasis, particularly in epithelial cells of the proximal tubule, liver, and intestine, with the kidney being most severely affected by its absence.

What cellular mechanisms are disrupted by Aquaporin-11 deletion?

Mechanistic studies of AQP11-null mice have provided insights into the cellular processes disrupted by AQP11 deletion:

  • Endosomal function:

    • Primary cultured cells from the proximal tubules of AQP11-null mice showed defective endosomal acidification

    • This suggests AQP11 may play a role in endosomal pH regulation or water balance

  • Cellular vacuolization:

    • Vacuole formation in proximal tubule cells appears to be an early event preceding cyst formation

    • Similar vacuolization observed in hepatocytes and intestinal epithelia

    • The rough endoplasmic reticulum is particularly affected in liver-specific knockout mice

  • Potential nutrient transport:

    • Based on expression patterns and knockout phenotypes, AQP11 may be involved in nutrient transport, particularly in the testis

For researchers investigating AQP11's cellular functions, experimental approaches should include:

  • Detailed ultrastructural analysis of affected cells

  • Measurement of organelle pH and function in wild-type versus knockout cells

  • Analysis of membrane trafficking pathways

  • Investigation of potential interactions with other transporters or channels

How do tissue-specific knockouts of Aquaporin-11 differ from global knockout models?

Tissue-specific knockout models have been valuable in distinguishing primary from secondary effects of AQP11 deletion. The liver-specific AQP11 knockout model demonstrates important differences from the global knockout:

  • Liver-specific knockout phenotype:

    • Allows study of AQP11 function in the liver without the confounding effects of renal failure

    • Shows rapid vacuolization of the rough endoplasmic reticulum specifically in periportal hepatocytes after amino acid feeding

    • Mice survive beyond weaning, unlike global knockout mice

  • Comparison with global knockout:

    • Confirms the direct role of AQP11 in hepatocyte function, independent of renal effects

    • Suggests tissue-specific functions or vulnerabilities to AQP11 loss

    • Provides evidence that proximal tubule dysfunction in global knockout is a primary rather than secondary effect

For researchers designing knockout studies, considerations should include:

  • Use of Cre-loxP systems for tissue-specific deletion

  • Careful timing of knockout induction if using inducible systems

  • Comprehensive phenotyping across multiple organ systems

  • Consideration of potential compensatory mechanisms in tissue-specific versus global knockouts

What experimental models are optimal for studying recombinant mouse Aquaporin-11?

Selecting appropriate experimental models is crucial for successful AQP11 research. Based on published studies, the following approaches have proven effective:

How can researchers effectively measure water transport activity of recombinant Aquaporin-11?

Measuring the water transport activity of AQP11 presents unique challenges due to its intracellular localization. Based on successful approaches in the literature:

  • Liposome reconstitution method:

    • Express and purify recombinant AQP11 using appropriate detergents (Fos-choline 10 has been effective)

    • Reconstitute purified protein into liposomes

    • Perform stopped-flow measurements to quantify water permeability

    • Calculate single water permeability (pf) values

  • Experimental considerations:

    • Ensure proper protein orientation in liposomes

    • Include appropriate controls (empty liposomes)

    • Consider temperature dependence of water transport

    • Validate functional activity through multiple technical replicates

  • Data analysis approach:

    • Apply appropriate kinetic models to stopped-flow data

    • Calculate permeability coefficients

    • Compare with other aquaporins as reference standards

This methodology has successfully demonstrated that despite its divergent NPA motifs, AQP11 functions as a water channel with quantifiable permeability (1.72±0.03×10^-13 cm^3/s) .

What are the key unresolved questions in Aquaporin-11.research?

Despite significant progress in understanding AQP11, several important questions remain unresolved:

  • Structural determinants of function:

    • How do the divergent NPA motifs affect water selectivity and permeability?

    • What is the three-dimensional structure of AQP11 and how does it compare to classical aquaporins?

  • Precise subcellular roles:

    • Which intracellular organelles contain functional AQP11?

    • How does AQP11 contribute to endosomal acidification and function?

    • Is AQP11 involved in transporting molecules other than water?

  • Developmental regulation:

    • What factors control the tissue-specific and developmentally regulated expression of AQP11?

    • What is the significance of delayed expression in testis?

  • Pathophysiological implications:

    • Could AQP11 dysfunction contribute to human disease, particularly polycystic kidney diseases?

    • Are there potential therapeutic approaches targeting AQP11 or its downstream effects?

Researchers entering this field should consider these knowledge gaps when designing studies to advance our understanding of this unique aquaporin family member.

What methodological advances would facilitate further research on Aquaporin-11?

Advancing AQP11 research would benefit from several methodological improvements:

  • Improved detection tools:

    • Development of more specific and sensitive antibodies

    • Generation of reporter mice expressing fluorescently tagged AQP11

  • Functional assays:

    • Development of cell-based assays for measuring AQP11 function in its native environment

    • Methods for acute manipulation of AQP11 activity (pharmacological or genetic)

  • Structural biology approaches:

    • Optimization of expression and purification for structural studies

    • Application of cryo-EM to determine high-resolution structure

  • Translational research tools:

    • Development of human cell models to study AQP11 function

    • Investigation of potential AQP11 variants in human disease cohorts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.