Recombinant Mouse Aquaporin-12 (Aqp12)

Shipped with Ice Packs
In Stock

Description

Pancreatic Fluid Secretion

AQP12 is critical for regulating pancreatic fluid dynamics under stress conditions:

  • Knockout Mouse Studies: AQP12-deficient mice (AQP12-KO) exhibit severe pancreatic damage during chemically induced pancreatitis compared to wild-type mice. This includes larger exocytotic vesicles in acinar cells under high cholecystokinin-8 (CCK-8) stimulation, suggesting impaired secretory control .

  • Human Relevance: Mutations in AQP12B (a human homolog) correlate with pancreatic dysfunction, reinforcing its role in fluid secretion .

ELISA Kits for Quantification

The Mouse Aquaporin-12 ELISA Kit (Assay Genie MOEB1502) enables precise measurement of AQP12 in biological samples:

ParameterSpecification
Detection Range0.312–20 ng/mL
Sensitivity0.166 ng/mL
Intra-Assay CV6.4%
Inter-Assay CV8.0%
Sample TypesSerum, plasma, tissue lysates
ReactivityMouse-specific

This kit uses a competitive assay format with high specificity for natural and recombinant AQP12 .

Recombinant Protein Controls

Recombinant Aqp12 fragments (e.g., CSB-CF807515MO from Cusabio) serve as blocking controls in Western blot (WB) and immunohistochemistry (IHC). A 100x molar excess of the fragment is recommended for antibody validation .

Research Implications and Future Directions

  • Therapeutic Targets: AQP12’s role in pancreatitis severity highlights its potential as a biomarker or intervention target for pancreatic disorders .

  • Mechanistic Studies: Further work is needed to resolve conflicting apoptosis data and clarify AQP12’s regulatory mechanisms during cell stress .

Table 2: AQP12-KO Phenotype Under CCK-8 Stimulation

ParameterWild-Type MiceAQP12-KO Mice
Pancreatic DamageModerateSevere
Exocytotic VesiclesNormal SizeEnlarged
Secretion EfficiencyIntactImpaired

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Aqp12; Aquaporin-12; AQP-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Aqp12
Target Protein Sequence
MASLNVSLCFFFATCAICEVARRASKALLPAGTYASFARGAVGAAQLAACCLEMRVLVELGPWAGGFGPDLLLTLVFLLFLVHGVTFDGASANPTVALQEFLMVEASLPNTLLKLSAQVLGAQAACALTQRCWAWELSELHLLQSLMAAHCSSTLRTSVLQGMLVEGACTFFFHLSLLHLQHSLLVYRVPALALLVTLMAYTAGPYTSAFFNPALAASVTFHCPGNTLLEYAHVYCLGPVAGMILAVLLHQGHLPRLFQRNLFYRQKSKYRTPRGKLSPGSVDAKMHKGE
Uniprot No.

Target Background

Function
Aquaporins facilitate the transmembrane transport of water and small, neutral solutes.
Gene References Into Functions
  1. AQP12 plays a role in digestive enzyme secretion, specifically in the maturation and exocytosis of secretory granules. PMID: 15809071
  2. AQP12 may be involved in regulating the proper secretion of pancreatic fluid following rapid and intense stimulation. PMID: 19726746
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, AQP11/AQP12 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Restricted to pancreatic acinar cells.

Q&A

What is Aquaporin-12 and how does it differ from other aquaporins?

Aquaporin-12 (AQP12) is the most recently identified member of the mammalian aquaporin family, which comprises 13 membrane water channel proteins. Unlike most aquaporins that localize to the cell plasma membrane, AQP12 is distinctively expressed at intracellular sites. AQP12 is specifically expressed in pancreatic acinar cells, suggesting a specialized role in pancreatic function. This intracellular localization represents a significant departure from the typical membrane-bound location of other aquaporins like AQP1 and AQP4, which primarily facilitate transmembrane water transport .

The aquaporin family generally forms tetramers in membranes, with each monomer approximately 30kD in size and containing six transmembrane helical domains. While most aquaporins facilitate water transport across cell plasma membranes, some (aquaglyceroporins such as AQP3, AQP7, and AQP9) also transport glycerol. The specialized subcellular localization of AQP12 suggests it may have unique physiological functions distinct from the more well-characterized membrane-bound aquaporins .

What are the gene and protein characteristics of mouse Aquaporin-12?

Mouse Aquaporin-12 has several aliases including AQP-12, AQP-12B, aquaporin X2, and insulin synthesis associated 3 (INSSA3). The corresponding gene aliases include AQP-12, AQP12, AQP12A, AQP12B, AQPX2, and INSSA3. While the search results don't provide the specific gene ID for mouse AQP12, they mention human UniProt IDs Q8IXF9 and A6NM10 for comparison .

When examining sequence homology, recombinant human AQP12 protein fragments show highest antigen sequence identity to mouse and rat orthologs at approximately 42%, indicating moderate conservation across these mammalian species. This level of sequence conservation suggests that while core functional domains may be preserved, there might be species-specific adaptations in AQP12 structure and function .

How is recombinant mouse AQP12 typically produced for research applications?

While the search results don't specifically detail production methods for recombinant mouse AQP12, we can infer approaches based on information about other recombinant aquaporins. Recombinant aquaporins are commonly expressed in mammalian expression systems such as HEK293 cells to ensure proper protein folding and post-translational modifications. For instance, recombinant mouse AQP1 is produced in HEK293 cells with affinity tags such as His, Fc, or Avi tags to facilitate purification and detection .

For recombinant aquaporin proteins, purification typically involves affinity chromatography using the incorporated tags, followed by quality control assessments including SDS-PAGE for purity determination (typically ≥85%) and endotoxin testing (<1.0 EU per μg) using the LAL method. Storage recommendations typically include aliquoting in PBS buffer and storing at -20°C to -80°C to avoid repeated freeze-thaw cycles that could compromise protein integrity .

What experimental models are available to study AQP12 function?

The primary experimental model for studying AQP12 function is the AQP12 knockout mouse (AQP12-KO). These genetically modified mice have been generated to investigate the physiological roles of AQP12 in the pancreas. Under normal physiological conditions, AQP12-KO mice show no obvious phenotypic differences compared to wild-type mice in terms of growth, blood chemistry, pancreatic fluid content, or histology .

For comparative studies, researchers might consider generating transgenic mouse models with AQP12 overexpression, similar to the GFAP-AQP4 transgenic models described for AQP4 research. Such models would allow investigation of whether increased AQP12 expression might enhance protection against pancreatic damage or potentially cause other physiological effects .

What are the recommended immunodetection methods for mouse AQP12?

Based on protocols used for other aquaporins, effective immunodetection of AQP12 would likely involve a combination of immunoblotting (Western blot) and immunofluorescence techniques. For immunoblotting, tissue homogenization protocols similar to those used for brain aquaporin studies could be adapted for pancreatic tissue. This typically involves homogenization in a buffer containing 250 mM sucrose, 10 mM Tris-HCl (pH 7.4), 0.2 mM EDTA, and protease inhibitors like phenylmethylsulfonyl fluoride (20 μg/ml) .

For protein separation and detection, standard SDS-PAGE followed by transfer to Hybond-P membranes or equivalent would be appropriate. Blocking with 5% nonfat milk and incubation with specific anti-AQP12 antibodies would follow. Detection systems such as ECL Plus could be used for visualization. Quantification should use appropriate reference proteins (such as β-actin) for normalization .

For immunofluorescence, tissues should be fixed in 4% paraformaldehyde, equilibrated with 30% sucrose, and sectioned (6-μm thickness). After blocking with 3% nonfat milk, sections would be incubated with primary antibodies against AQP12, followed by appropriate fluorescently-labeled secondary antibodies. Nuclear counterstaining with DAPI and mounting with appropriate medium would complete the procedure .

How can researchers validate the specificity of anti-AQP12 antibodies?

Antibody validation is crucial for aquaporin research due to potential cross-reactivity with other family members. For validating anti-AQP12 antibodies, researchers should implement several complementary approaches. First, blocking experiments using recombinant protein fragments can confirm antibody specificity. A recommended approach is to pre-incubate the antibody with a 100x molar excess of the corresponding protein control fragment for 30 minutes at room temperature before use in immunohistochemistry, immunocytochemistry, or Western blot applications .

Second, using tissues from AQP12-KO mice as negative controls provides an excellent specificity check. Absence of staining or bands in knockout tissues confirms antibody specificity. Third, comparing expression patterns with known AQP12 distribution (primarily in pancreatic acinar cells) can further validate antibody performance .

For quantitative analyses, researchers should establish standard curves using recombinant AQP12 protein of known concentration and perform appropriate controls including omission of primary antibody, isotype controls, and pre-absorption controls to ensure reliable and reproducible results.

How does AQP12 function differ from other aquaporins in stress conditions?

AQP12 exhibits distinctive behavior under stress conditions compared to other aquaporins. While AQP12-KO mice show no obvious phenotypic differences under normal conditions, they display increased susceptibility to pancreatitis when challenged with CCK-8 analog, suggesting a protective role specifically during pancreatic stress . This contrasts with AQP4, where knockout produces protective effects in cytotoxic brain edema models but detrimental effects in vasogenic edema and hydrocephalus models .

The distinctive intracellular localization of AQP12 suggests it might regulate internal water balance within pancreatic acinar cells rather than transmembrane water flow, which is the primary function of plasma membrane-localized aquaporins. This internal regulation could be critical during secretory stress in pancreatic acinar cells, which undergo significant osmotic challenges during digestive enzyme secretion cycles .

Unlike AQP4, whose expression levels directly correlate with the rate of brain water accumulation in overexpression models, the relationship between AQP12 expression levels and pancreatic function remains to be fully characterized. Future studies comparing AQP12 knockout, wild-type, and overexpression models under various stress conditions would help elucidate its precise role in pancreatic pathophysiology .

What are the experimental considerations when studying AQP12 in pancreatic disease models?

When designing experiments to study AQP12 in pancreatic disease models, several important considerations emerge. First, researchers should carefully select appropriate induction methods for pancreatic stress. The CCK-8 analog approach has proven effective in revealing phenotypic differences between AQP12-KO and wild-type mice. Alternative models of pancreatic injury, such as cerulein-induced pancreatitis, alcohol and fatty acid ethyl ester exposure, or bile acid infusion might unveil different aspects of AQP12 function .

Second, comprehensive phenotyping beyond gross histology is essential. This should include measurements of:

  • Serum amylase and lipase levels

  • Pancreatic edema (wet/dry weight ratio)

  • Myeloperoxidase activity (neutrophil infiltration)

  • Inflammatory cytokine profiles

  • Acinar cell death markers (apoptosis vs. necrosis)

  • Endoplasmic reticulum stress indicators

Third, temporal dynamics should be assessed by examining different time points after induction of pancreatic stress. AQP12's protective effects might be most pronounced during specific phases of disease progression. Finally, considering AQP12's intracellular localization, organelle-specific analyses including endoplasmic reticulum and secretory vesicle function should be included to understand the subcellular mechanisms of AQP12 action .

What techniques can be used to study the intracellular trafficking and localization of AQP12?

Given AQP12's distinctive intracellular localization, specialized techniques are required to study its trafficking and precise subcellular distribution. Advanced imaging approaches including confocal microscopy with organelle-specific markers would be essential. Co-localization studies using markers for endoplasmic reticulum (e.g., calnexin, KDEL), Golgi apparatus (e.g., GM130), secretory vesicles (e.g., VAMP2), and zymogen granules would help establish the exact intracellular compartment(s) where AQP12 resides .

Super-resolution microscopy techniques such as stimulated emission depletion (STED) microscopy or photoactivated localization microscopy (PALM) could provide more detailed insights into AQP12's nanoscale organization within cellular compartments. For dynamic trafficking studies, live-cell imaging of fluorescently tagged AQP12 would allow tracking of its movement in response to secretory stimuli or stress conditions .

Biochemical approaches including subcellular fractionation and organelle isolation, followed by immunoblotting for AQP12, could complement imaging studies. Additionally, proteomic analysis of AQP12-containing compartments might identify interaction partners that regulate its trafficking and function. For studying potential post-translational modifications affecting AQP12 localization, mass spectrometry-based phosphoproteomic or glycoproteomic analyses would be valuable .

How does mouse AQP12 compare with human AQP12 in structure and function?

Mouse and human AQP12 share moderate sequence homology, with approximately 42% antigen sequence identity based on available recombinant protein fragment data. This level of conservation suggests potential differences in structure and possibly function between the species. Unlike some highly conserved aquaporins (such as AQP1 with >80% cross-species homology), the moderate conservation of AQP12 indicates it may have undergone more rapid evolutionary changes, potentially reflecting species-specific adaptations in pancreatic function .

The functional implications of these sequence differences remain largely unexplored. Human AQP12 exists in two forms (AQP12A and AQP12B), and it's important to determine whether mouse AQP12 is functionally more similar to one of these human isoforms. Cross-species complementation studies, where human AQP12 is expressed in mouse AQP12-KO models, could help determine functional equivalence .

Structural predictions based on known aquaporin crystal structures combined with the specific sequence variations between mouse and human AQP12 might provide insights into potential functional differences. Advanced structural biology approaches such as cryo-electron microscopy could eventually reveal the detailed molecular architecture of AQP12 from different species and how this relates to their function.

What experimental approaches can determine if AQP12 functions as a water channel or has other transport functions?

Determining the transport function of AQP12 presents unique challenges due to its intracellular localization. Unlike plasma membrane aquaporins that can be readily studied in oocyte swelling assays or membrane vesicle transport studies, intracellular AQP12 requires specialized approaches. One strategy would involve isolating organelles containing AQP12 and measuring their water permeability using stopped-flow light scattering techniques or fluorescent probes sensitive to volume changes .

Another approach would be to redirect AQP12 to the plasma membrane through mutation of trafficking signals or fusion with appropriate targeting sequences, allowing conventional water transport assays. For testing whether AQP12 functions as an aquaglyceroporin, similar strategies could be employed using glycerol or other potential substrates. Site-directed mutagenesis of the putative pore region, based on homology with other aquaporins, could identify critical residues for substrate selectivity .

Complementary approaches could include:

  • Reconstitution of purified recombinant AQP12 into proteoliposomes for transport measurements

  • Development of intracellular fluorescent sensors that can detect water or solute movement across AQP12-containing compartments

  • Measurement of organelle volume changes in response to osmotic challenges in wild-type versus AQP12-KO cells

These approaches would help determine whether AQP12 functions primarily as a water channel, transports other solutes, or serves another function entirely .

What is the current understanding of AQP12's role in pancreatic pathophysiology?

This observation suggests that AQP12 plays a protective role during pancreatic stress conditions. The mechanism underlying this protection remains to be fully elucidated but may involve:

  • Regulation of water balance within pancreatic acinar cells during secretory activity

  • Maintenance of organelle volume homeostasis during stress

  • Potential roles in zymogen granule formation or exocytosis

  • Protection against premature activation of digestive enzymes within the pancreas

Given that AQP12 is specifically expressed in pancreatic acinar cells and localized intracellularly, its function is likely related to the unique secretory processes of these cells. The precise molecular pathways through which AQP12 exerts its protective effects remain an important area for future research, with potential implications for understanding and treating pancreatitis and other pancreatic disorders .

What are promising research areas for AQP12 beyond pancreatic function?

While AQP12 is primarily expressed in pancreatic acinar cells, exploring its potential roles in other tissues represents an exciting frontier. Based on patterns observed with other aquaporins, researchers should investigate whether AQP12 is expressed at lower levels in other secretory epithelia or specialized cell types. Transcriptomic and proteomic screening across diverse tissues might reveal previously undetected expression patterns, particularly under specific physiological or pathological conditions .

Another promising avenue involves exploring potential connections between AQP12 and metabolic regulation. The gene alias "insulin synthesis associated 3" (INSSA3) suggests a possible relationship with insulin biology that warrants investigation. Examining AQP12 expression and function in pancreatic β-cells or in metabolic disease models might uncover novel roles beyond its established presence in acinar cells .

The intracellular localization of AQP12 also raises interesting questions about organelle water homeostasis in cellular processes beyond secretion. Investigating potential roles in endoplasmic reticulum stress responses, autophagy, or organelle volume regulation during cell division could open new research directions. Comparative studies across species with different metabolic rates or pancreatic functions might also reveal evolutionary adaptations in AQP12 function .

How might recombinant AQP12 be used in developing therapeutics for pancreatic disorders?

The protective role of AQP12 in pancreatitis models suggests potential therapeutic applications. Recombinant AQP12 could serve as a platform for developing targeted therapies for pancreatic disorders in several ways. First, high-throughput screening using recombinant AQP12 could identify small molecules that enhance its function or expression, potentially offering protection against pancreatitis or accelerating recovery .

Second, understanding the structural features of AQP12 that confer protection during pancreatic stress could inform the design of peptide mimetics or other compounds that replicate this protective function. These might serve as novel therapeutics for acute or chronic pancreatitis .

Third, recombinant AQP12 could be used to develop immunotherapeutic approaches. If autoantibodies against AQP12 are identified in certain pancreatic disorders (similar to AQP4 antibodies in neuromyelitis optica), recombinant protein could be used to develop diagnostic assays and potential therapeutic interventions .

Finally, gene therapy approaches targeting AQP12 expression in pancreatic acinar cells might offer a strategy for enhancing resistance to pancreatitis in high-risk patients. Pre-clinical testing of such approaches would rely heavily on recombinant AQP12 for validation studies and development of delivery methods .

What methodological advances would enhance AQP12 research?

Several methodological advances would significantly enhance AQP12 research. First, developing improved antibodies with higher specificity and sensitivity for mouse AQP12 would facilitate more detailed localization studies. Current approaches using protein fragment controls for antibody validation provide a foundation, but next-generation antibodies, potentially including recombinant antibodies with defined epitopes, would advance the field .

Second, creating conditional and inducible AQP12 knockout models would allow more precise temporal control over AQP12 expression. This would help distinguish between developmental roles and acute functions of AQP12 and avoid potential compensatory mechanisms that might occur in conventional knockouts .

Third, developing fluorescent protein-tagged AQP12 constructs that maintain proper intracellular targeting would enable live-cell imaging studies. Combined with advances in super-resolution microscopy, this would provide unprecedented insights into AQP12 dynamics during secretory processes and under stress conditions .

Fourth, establishing pancreatic organoid cultures from wild-type and AQP12-KO mice would provide more accessible experimental systems than whole animals. Such organoids could be used for detailed functional studies, drug screening, and investigation of AQP12 interactions with other cellular components .

Finally, applying emerging proteomic approaches to identify the AQP12 interactome would provide crucial insights into its functional partnerships and regulatory mechanisms, potentially revealing new therapeutic targets for pancreatic disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.