Recombinant Mouse Aquaporin-3 (Aqp3)

Shipped with Ice Packs
In Stock

Description

Research Applications and Findings

Recombinant Aqp3 is central to studying its roles in physiology and pathology:

Skin Physiology

  • Differentiation and Hydration: Aqp3 re-expression in knockout mice restores glycerol uptake, promoting keratinocyte differentiation and stratum corneum hydration .

  • Wound Healing: Glycerol transport via Aqp3 supports lipid biosynthesis and barrier repair, as shown in Aqp3-deficient mice with delayed wound closure .

Cancer Biology

  • Metastasis and EMT: Overexpression of Aqp3 correlates with epithelial-to-mesenchymal transition (EMT) in breast, gastric, and melanoma cancers. Knockout models show reduced tumor growth and metastasis .

  • Signaling Pathways: Aqp3 modulates PLD2 activity, enhancing cell proliferation and migration .

Gut Health

  • Barrier Function: Aqp3 knockdown in intestinal epithelial cells increases bacterial translocation and reduces tight junction proteins (e.g., occludin, claudin-1) .

  • Pathogen Interactions: Downregulated Aqp3 in PEDV-infected piglets correlates with viral replication, suggesting a protective role against enteric pathogens .

Immunology

  • Antigen Presentation: Aqp3 mediates hydrogen peroxide entry into endosomes, enabling lipid peroxidation and cross-presentation of antigens. AQP3-deficient mice show impaired anti-viral responses .

Detection and Functional Analysis

Recombinant Aqp3 is analyzed using specialized techniques:

Table 3: Detection Methods for Aqp3

MethodApplicationSensitivity/Resolution
ELISA (Mouse Aqp3)Quantify serum/tissue Aqp3 levels0.078 ng/mL
Western BlottingConfirm protein expression/purity~30 kDa band
Functional AssaysMeasure water/glycerol transport[³H]glycerol uptake

Therapeutic and Inhibitory Studies

  • Cancer Therapy: Rottlerin inhibits Aqp3-mediated glycerol transport (IC₅₀: 6.7 µM), reducing cancer cell migration. Molecular docking reveals interactions with extracellular pore residues .

  • Dermatological Disorders: SAHA-induced Aqp3 upregulation may treat psoriasis, where Aqp3 levels are reduced .

Future Directions

  • Drug Development: Targeting Aqp3 with inhibitors like rottlerin for metastatic cancers .

  • Gut Disease Models: Recombinant Aqp3 in intestinal organoids to study barrier dysfunction in IBD or viral infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly contact your local distributors for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors: storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
In general, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Aqp3; Aquaporin-3; AQP-3; Aquaglyceroporin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Aqp3
Target Protein Sequence
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI
Uniprot No.

Target Background

Function
Aquaporin-3 (AQP3) is a water channel essential for facilitating glycerol permeability and water transport across cell membranes. It functions as a glycerol transporter in the skin, playing a pivotal role in regulating stratum corneum (SC) and epidermal glycerol content. AQP3 is implicated in skin hydration, wound healing, and tumorigenesis. In the kidney's medullary collecting duct, it provides high water permeability, enabling water to move along osmotic gradients. While exhibiting slight permeability to urea, AQP3 might also function as a water and urea exit mechanism in antidiuresis within collecting duct cells. Furthermore, it may play a significant role in gastrointestinal tract water transport and glycerol metabolism.
Gene References Into Functions
  1. Research findings indicate a novel role for AQP3 in modulating renal injury and suggest mechanisms involved in protection against hypoxic injury. PMID: 28344130
  2. This study's results suggest that NAR relieves Lop-induced constipation by increasing the levels of interstitial cells of Cajal markers (c-Kit and SCF), as well as AQP3. Therefore, NAR could be a potential therapeutic candidate for patients suffering from lifestyle-induced constipation. PMID: 29207043
  3. Increased expression of AQP3 and AQP10 in murine skin, accompanied by inflammatory stimuli (IMQ) and contact with detergent-containing water, enhances skin acanthosis and affects keratinocyte biology. PMID: 28111811
  4. AQP3(-/-) mice exhibit impaired healing of superficial wounds in the colon and compromised mucosal innate immune responses against Citrobacter rodentium infection. PMID: 28049834
  5. These results imply a critical role of AQP3 in asthma. PMID: 27165276
  6. This study found that both the airway epithelial cells of AQP3-knockout mice and AQP3-knockdown HBECs exhibit a significant impairment in self-healing capacity, with defective epithelial cell migration due to AQP3-facilitated glycerol transport. PMID: 27524635
  7. Decreased glycerol efflux from skeletal muscles in AQP3 knockout mice may contribute to reduced exercise capacity. PMID: 27138166
  8. Treatment of human HepG2 cells with TCDD also increased the expression of AQP3 mRNA and protein. PMID: 26454884
  9. AQP3-facilitated H2O2 transport is essential for NF-kappaB activation in keratinocytes, contributing to the development of psoriasis. PMID: 26100668
  10. The study investigated the effect of the total tannins extract of rhubarb on the expression of aquaporin 2 and aquaporin 3 in diarrheal mice. PMID: 25215286
  11. AQP3 plays a pro-differentiative role in epidermal keratinocytes, and PLD2 activity is necessary for this effect. PMID: 25233074
  12. The study analyzed the molecular link between the circadian clock and AQP3 function in mouse dorsal skin and HaCaT cells. PMID: 24418925
  13. In a mouse model of intestinal ischemia, the level of miR-874 expression was inversely related to AQP3 protein expression. PMID: 24462679
  14. Data indicate selective expression of aquaporins 3 and 8 in primitive erythroblasts and aquaporins 1 and 9 in adult definitive erythroblasts. PMID: 23243273
  15. We therefore suggest that AQP3-mediated H(2)O(2) uptake is required for chemokine-dependent T cell migration, enabling sufficient immune response. PMID: 22927550
  16. It was concluded that acyl-CoA binding protein, via aquaporin 3, is necessary for intact urine concentrating ability through efflux over the basolateral membrane of the collecting duct. PMID: 22237802
  17. The results of this study suggest that Gypsum fibrosum plays a crucial role in the increased levels of cutaneous AQP3 expression enhanced by Byakkokaninjinto. PMID: 22138657
  18. AQP3 serves as a novel determinant in macrophage immune function through a cellular mechanism involving facilitated water and glycerol transport, subsequently influencing phagocytic and migration activity. PMID: 21865318
  19. PPARgamma activation stimulates AQP3 expression, providing an additional mechanism by which PPAR activators regulate epidermal function. PMID: 21457357
  20. These results indicate that AQP3 may play a role in modulating dendritic cell population and migration. PMID: 21871666
  21. The AQP1 and AQP3 genes were expressed in the secretory epithelia of the mouse prostate tissue, suggesting that AQP1 and AQP3 may play a significant role in prostatic fluid secretion. PMID: 21735643
  22. Aquaporin 3 is an essential membrane pathway for sperm regulatory volume decrease, balancing the trade-off between sperm motility and cell swelling during physiological hypotonicity. PMID: 21135872
  23. The results indicate that AQP3 is crucial for immature oocytes to acquire their full growth potential within antral follicles. PMID: 20509986
  24. AQP3 is involved in epidermal hyperplasia through a mechanism that includes upregulated AQP3 expression and subsequent enhancement of keratinocyte proliferation. PMID: 21191421
  25. Research has established that AQP3 is required for Nox-derived H(2)O(2) signaling upon growth factor stimulation. PMID: 20724658
  26. Impaired stratum corneum hydration in mice lacking epidermal water channel aquaporin-3. PMID: 11880378
  27. This research provides the first functional evidence for physiologically important glycerol transport by an aquaporin. PMID: 12270942
  28. Phosphatidylglycerol, as a bioactive lipid, could potentially mediate the effects of the aquaporin 3-phospholipase D2 signaling module, with aquaporin 3 acting as a modulatory unit, in the regulation of keratinocyte function. PMID: 14675200
  29. Upregulation of the UT-A2 urea transporter and the aquaporin 2 (AQP2) and AQP3 water channel transcripts, but no change in other urea transporters or AQP in urea transporter B null mice. PMID: 15100356
  30. Aquaporin-1, -3, and -5 exhibit water-transporting properties in the cornea and conjunctiva. PMID: 15557451
  31. AQP3 was detected in the alveolar epithelium and duct system. PMID: 15844003
  32. Mechanistic analysis of the altered skin phenotype in AQP3 deficiency suggests that glycerol, rather than water transport, is essential for AQP3's role in skin physiology. PMID: 15966863
  33. An NH2-terminal sorting signal mediates the basolateral targeting of AQP3. PMID: 16135541
  34. This study highlights a novel role for AQP3 in the non-urea solute concentration in urine. PMID: 16525162
  35. Research demonstrates that during Enterobacterial infection, AQP2 and AQP3 are mislocalized from their typical positions along cell membranes to the cell cytoplasm. This shift correlates with the diarrheal phenotype observed in infected mice. PMID: 16889624
  36. AQP3 provides PLD2 with glycerol for synthesizing PG, a lipid signal that promotes early keratinocyte differentiation. PMID: 17597824
  37. AQP3 may thus be a crucial determinant in skin tumorigenesis, potentially serving as a novel target for tumor prevention and therapy. PMID: 17967887
  38. Evidence supports the involvement of AQP3-facilitated water transport in epidermal cell migration and AQP3-facilitated glycerol transport in epidermal cell proliferation. PMID: 17968524
  39. AQP3 could play a significant role in controlling oocyte quality, and a lower in vitro fertilization rate in controlled ovarian hyperstimulation mice may partly result from reduced AQP3 expression and water permeability in mouse oocytes. PMID: 18209479
  40. AQP3 has minimal influence on keratinocyte differentiation but supports its proposed role in AQP3-facilitated cell proliferation. PMID: 19184071
  41. Aquaporins are common targets of gene expression in both allergen and IL-13 induced mouse models of asthma. PMID: 19237298
  42. Blockade of MAPK14/11 negated the increase in Aqp 3 and 9 mRNA levels, whereas culture in a MAPK8 blocker did not in preimplantation embryo. PMID: 19258345

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in principal cells in collecting ducts in kidney medulla (at protein level). Renal medulla and colon. Predominantly in the inner medulla. Expressed in basal layer of epidermal keratinocytes.

Q&A

What expression systems are available for recombinant mouse Aqp3 production and how do they affect protein function?

Multiple expression systems are employed for recombinant mouse Aqp3 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical YieldSource
E. coliCost-effective, high yield, simplicityLacks post-translational modifications, potential improper folding of membrane proteinsVariable
HEK293TMammalian post-translational modifications, proper foldingHigher cost, longer production time>0.05 μg/μL
YeastPost-translational modifications, high yieldDifferent glycosylation patterns than mammalsNot specified
BaculovirusInsect cell-based modifications, high-level expressionComplex system, more costlyNot specified

For functional studies, mammalian expression systems like HEK293T are often preferred as they maintain proper protein folding and membrane integration critical for channel function .

What are the optimal storage and handling conditions for maintaining recombinant mouse Aqp3 activity?

To maintain optimal activity of recombinant mouse Aqp3:

  • Store at -80°C for long-term stability

  • Use buffers containing 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol to prevent denaturation

  • Avoid repeated freeze-thaw cycles which significantly reduce activity

  • For cell culture applications, filter before use (note that some protein loss may occur during filtration)

  • Protein remains stable for approximately 12 months under proper storage conditions

  • For reconstitution into membrane systems, gentle detergents may be required to maintain the native conformation of this transmembrane protein

How can researchers verify the identity and purity of recombinant mouse Aqp3?

Multiple analytical techniques should be employed for comprehensive verification:

  • SDS-PAGE and Coomassie staining: Should demonstrate >80% purity with a band at approximately 31.6 kDa for tagged protein

  • Western blotting: Using anti-Aqp3 or anti-tag antibodies to confirm identity

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Functional assays: Water/glycerol transport assays to confirm biological activity

  • Immunofluorescence: When expressed in cells, should localize to plasma membrane and intracellular compartments

Expression validation can utilize commercially available anti-Aqp3 antibodies that detect the protein across multiple species .

What functional assays can effectively measure the multiple transport capabilities of recombinant mouse Aqp3?

Aqp3 uniquely transports water, glycerol, and hydrogen peroxide, requiring distinct assay systems:

Water Transport Measurement:

  • Calcein fluorescence-quenching assays in living cells (as demonstrated in wild-type vs. AQP3-null mice)

  • Osmotic swelling assays in proteoliposomes or vesicles containing recombinant Aqp3

  • Transepithelial water flux measurements in polarized cell cultures expressing Aqp3

Glycerol Transport Measurement:

  • 14C-glycerol uptake assays (validated in wild-type vs. AQP3-null mice)

  • FRET-based sensors for real-time monitoring of intracellular glycerol concentration changes

  • Glycerol-induced cell volume changes measured by light scattering

Hydrogen Peroxide Transport Measurement:

  • rHyPer (fluorescent H₂O₂ sensor) assays to detect phagosomal H₂O₂ levels in cells expressing wild-type vs. channel-mutant Aqp3

  • C11-bodipy fluorescence-based lipid peroxidation assays to measure downstream effects of H₂O₂ transport

  • H₂O₂-specific electrode measurements in reconstituted membrane systems

Research has shown that channel mutants (e.g., A213W and G203H) can be used as negative controls since they abolish specific transport functions while maintaining protein expression .

How can researchers distinguish between the roles of Aqp3 and other aquaporins in experimental models?

Distinguishing Aqp3's specific contributions requires a multi-faceted approach:

  • Genetic approaches:

    • AQP3-knockout mice (which show impaired corneal re-epithelialization, reduced water/glycerol permeability, and delayed wound healing)

    • siRNA/shRNA knockdown specific to Aqp3 (shown to increase PEDV viral titers)

    • CRISPR/Cas9 gene editing for targeted Aqp3 modifications

  • Pharmacological approaches:

    • Mercury compounds (HgCl₂, CuSO₄) inhibit Aqp3 function and induce diarrhea in rat models

    • Channel-specific inhibitors when available

  • Structure-function studies:

    • Expression of water-selective AQP3 G203H mutant to distinguish water transport from glycerol/H₂O₂ transport

    • AQP3 mislocalization mutants (2xLLmut) to study subcellular localization importance

  • Comparative expression analysis:

    • Quantitative comparison of AQP subtypes in tissues (e.g., AQP3 is dominant in rat colon mucosa compared to AQP4 and AQP8)

    • Differential subcellular localization (AQP3 shows distinct intracellular distribution compared to plasma membrane-localized AQP9)

What role does recombinant mouse Aqp3 play in endosome-to-cytosol transfer and how can this be investigated?

Recent research has identified Aqp3 as a regulator of endosome-to-cytosol transfer (ECT), critical for antigen cross-presentation in immune responses:

Mechanism of Aqp3 in ECT:

  • Aqp3 facilitates H₂O₂ entry into endosomal lumen

  • Endosomal H₂O₂ promotes lipid peroxidation

  • Lipid peroxidation compromises membrane integrity, allowing antigen release into cytosol

Methodological approaches to study this function:

  • β-lactamase ECT assay:

    • Demonstrated that wild-type Aqp3 increases ECT while channel mutants (A213W) or water-selective mutants (G203H) do not

    • Can be used to screen other aquaporin family members (AQP2, AQP9) for comparative analysis

  • Phagosomal H₂O₂ measurement:

    • Using rHyPer (fluorescent H₂O₂ sensor) demonstrated that wild-type Aqp3 maintains elevated phagosomal H₂O₂ compared to channel mutants

  • Lipid peroxidation assessment:

    • C11-bodipy fluorescence-based lipid peroxidation assay showed decreased phagosomal lipid peroxidation in AQP3-/- cells

  • In vivo cross-presentation:

    • AQP3-/- mice show reduced ability to mount anti-viral responses and cross-present exogenous peptides

How can researchers effectively study the contribution of Aqp3 to intestinal health and disease models?

Aqp3 plays critical roles in intestinal water transport, barrier function, and inflammatory responses, requiring specialized methodologies:

Intestinal expression analysis:

  • Immunofluorescence has demonstrated Aqp3 expression at both apical and basal sides of mucosal epithelial cells in rat colon

  • Expression changes during adaptation (upregulated in rat residual ileum after small bowel resection)

  • Downregulated during pathological conditions like ETEC K88 challenge in weaned piglets

Disease models for studying Aqp3:

  • ETEC-induced diarrhea:

    • Aqp3 expression is progressively decreased after ETEC administration

    • Dietary interventions (berberine supplementation) can upregulate Aqp3 expression in ETEC-challenged models

  • Viral diarrhea models:

    • PEDV infection decreases Aqp3 expression in small intestine via methylation of specific CpG sites in the Aqp3 promoter

    • Rotavirus challenge increases Aqp3 expression in colon while decreasing other aquaporins

  • Barrier function assessment:

    • Trans-epithelial electrical resistance (TEER) measurements in cell models with modified Aqp3 expression

    • FITC-dextran permeability assays to assess barrier integrity

Recommended control experiments:

  • Species-matched controls (expression patterns differ between species)

  • Time-course analyses (expression changes over different time points post-challenge)

  • Multiple intestinal segments (jejunum, ileum, colon) as Aqp3 regulation varies by location

What strategies exist for investigating Aqp3-mediated cellular processes in skin inflammation and wound healing?

Aqp3's role in skin inflammation and wound healing can be investigated through several approaches:

Expression analysis in inflammatory conditions:

  • Aqp3 is upregulated in epidermal keratinocytes and dermal CD4+ T cells of rosacea patients and model mice

  • Immunohistochemistry and flow cytometry can quantify this upregulation

Functional analyses:

  • Cell migration assays:

    • Scratch wound assays using primary cultures of corneal epithelial cells from wild-type vs. AQP3-null mice demonstrated delayed healing

    • Time-lapse microscopy to track migration dynamics in Aqp3-expressing vs. deficient cells

  • Proliferation assays:

    • BrdU analysis of histologic sections shows reduced proliferating cells in AQP3-deficient mice during healing

    • [³H]thymidine uptake measurements in primary cell cultures

  • Inflammation markers:

    • NF-κB signaling modulation by Aqp3-mediated H₂O₂ transport

    • Chemokine-dependent T-cell migration dependent on Aqp3-mediated H₂O₂ transport

In vivo models:

  • Corneal re-epithelialization models show significant impairment in AQP3-null mice

  • Skin inflammation models (rosacea) demonstrate Aqp3 involvement in inflammatory pathways

What experimental approaches can evaluate the potential of Aqp3 as a therapeutic target?

Emerging research suggests Aqp3 as a potential therapeutic target for various conditions:

Validation approaches:

  • Genetic modulation:

    • Knockdown studies (AQP3 shRNA silencing increased PEDV infection)

    • Overexpression studies can confirm protective or pathogenic roles

  • Pharmacological modulation:

    • Mercury-based compounds inhibit Aqp3 but have toxicity concerns

    • Development of specific Aqp3 channel inhibitors/activators

  • Functional readouts for therapeutic efficacy:

    • Water/glycerol transport measurements

    • Disease-specific endpoints (e.g., diarrhea severity, skin inflammation scores, wound healing rates)

Disease-specific therapeutic potential:

  • Intestinal diseases:

    • Nutritional interventions that regulate Aqp3 expression (berberine, probiotics) for ETEC-induced diarrhea

    • Anti-viral therapy targeting Aqp3-dependent pathways

  • Skin disorders:

    • Targeting Aqp3 in keratinocytes and CD4+ T cells for rosacea treatment

    • Wound healing acceleration through Aqp3 modulation

  • Corneal injuries:

    • Enhancing Aqp3 function to accelerate corneal re-epithelialization

Experimental considerations:

  • Tissue-specific targeting to avoid systemic effects (e.g., kidney function)

  • Differentiation between water vs. glycerol vs. H₂O₂ transport for selective modulation

  • Species differences must be accounted for in translational research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.