Recombinant Mouse Aquaporin-9 (Aqp9)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized in E. coli using a plasmid encoding the mouse Aqp9 gene (UniProt ID: Q9JJJ3). Post-expression, it is purified via affinity chromatography leveraging the His-tag, followed by lyophilization for stability . This method ensures high yield and reproducibility for experimental use.

Immune Cell Studies

  • Dendritic Cell Maturation: Aqp9 is upregulated in murine bone marrow-derived dendritic cells (BMDCs) after LPS stimulation, facilitating glycerol transport for metabolic demands during inflammation. Recombinant Aqp9 enables studies on cytokine modulation, showing reduced IL-12 and increased IL-10 secretion in Aqp9-deficient BMDCs .

  • Neutrophil Migration: Aqp9 regulates F-actin polymerization in neutrophils, impacting chemotaxis during inflammatory responses .

Metabolic and Disease Research

  • Gluconeogenesis: Aqp9 mediates hepatic glycerol uptake, critical for glucose synthesis. Inhibitors like RG100204 (IC50 ~5 × 10⁻⁸ M) block Aqp9, elevating plasma glycerol in mice, a model for metabolic disorders .

  • Cancer Prognosis: High Aqp9 expression correlates with poor outcomes in colon and breast cancers but predicts better survival in gastric cancer, suggesting tissue-specific roles .

In Vitro Functional Assays

  • LPS-Induced Inflammation: Recombinant Aqp9 studies reveal its necessity for BMDC maturation, with knockout (KO) cells showing impaired IL-12 and TNFα secretion .

  • Inhibitor Screening: RG100204 blocks Aqp9-mediated glycerol transport in proteoliposomes, validating its use for in vivo metabolic studies .

In Vivo Implications

  • Colitis Models: Aqp9-KO mice exhibit reduced colonic IL-12 and elevated IL-10 during DSS-induced colitis, yet show no protection from acute inflammation, highlighting complex immune modulation roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
Aqp9; Aquaporin-9; AQP-9; Aquaglyceroporin-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Aqp9
Target Protein Sequence
MPSEKDRAKKNLVQRLALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM
Uniprot No.

Target Background

Function
Aquaporin-9 (AQP9) is a water channel protein with broad specificity. It is also permeable to glycerol and urea. AQP9 mediates the passage of a wide variety of small, non-charged solutes, including carbamides, polyols, purines, and pyrimidines.
Gene References Into Functions
  1. AQP9, selectively expressed in catecholaminergic neurons, is permeable to MPP+ and contributes to the selective vulnerability of nigral dopaminergic neurons by providing an entry route for parkinsonogenic toxins. PMID: 29566083
  2. Research indicates that an increase in aquaporin 9 expression in astrocytes is involved in astrogliosis. PMID: 28419510
  3. AQP-7 and -9 exhibit distinct staining patterns during different stages of the mouse estrus cycle. AQP-7 and -9-mediated glycerol transport in tanycyte cells might be regulated by hormones to utilize glycerol as a potential energy substrate during the mouse estrus cycle. PMID: 27746040
  4. Intracranial hemorrhage increases AQP9 protein levels in the hippocampus. The absence of AQP9 impairs neovascularization and exacerbates neuronal death following intracranial hemorrhage. PMID: 27885529
  5. The dynamics of liver AQP9 involvement in male rodent glycerol homeostasis provide a model that can be adapted to the human liver, serving as a significant module in a whole-body model of glucose metabolism in both health and metabolic diseases. PMID: 28049557
  6. These findings suggest that AQP9 is essential for the development of sensitization during cutaneous acquired immune responses through regulation of neutrophil function. PMID: 26489517
  7. Research implicates AQP9 in H2O2 transport in human and mouse cells. PMID: 26837049
  8. Results suggest that AQP9 is involved in liver steatosis. The reduction of hepatocyte AQP9 and, consequently, glycerol permeability, may be a protective mechanism against further fat infiltration in the liver parenchyma. PMID: 24205128
  9. The identification of novel, high-affinity AQP9 inhibitors in an intracellular binding site has been achieved. PMID: 23448163
  10. AQP9 deficiency leads to decreased redox-sensitive erythrocyte cation channel activity in mice. PMID: 22836670
  11. Data indicate selective expression of aquaporins 3 and 8 in primitive erythroblasts and aquaporins 1 and 9 in adult definitive erythroblasts. PMID: 23243273
  12. The liver glycerol permeability of Aqp9 null mice, while significantly lower than that in Aqp9(+/+) mice, did not increase during fasting. PMID: 22316404
  13. AQP9 and unidentified UT-A urea channels constitute the primary but redundant urea facilitators in murine hepatocytes. PMID: 23042941
  14. These findings not only confirm the presence of AQP9 in astrocytes but also suggest that changes in AQP9 expression alter glial energy metabolism. PMID: 22842525
  15. AQP9 plays a crucial role in the development of microgravity-induced bone loss and may be a potential target for the prevention or management of this condition. PMID: 22390930
  16. Acetaldehyde downregulates hepatocyte aquaporin 9 (AQP9) mRNA and AQP9 protein, while ethanol decreases hepatocyte AQP9 mRNA but not AQP9 protein. PMID: 21294757
  17. Aquaporin-9 protein is the primary route of hepatocyte glycerol uptake for glycerol gluconeogenesis in mice. PMID: 22081610
  18. This study investigated whether aquaporin (AQP) 9 is expressed in normal skeletal muscle at mRNA and protein levels. PMID: 19629726
  19. The findings indicate that, in addition to the initial uptake of trivalent inorganic As(III) inside cells, AQP9 plays a dual role in arsenic metabolite detoxification by facilitating efflux from cells. PMID: 19802720
  20. There is coordinated regulation of fat-specific and liver-specific glycerol channels, aquaporin adipose and aquaporin 9. PMID: 12351427
  21. AQP9 is expressed in a mucus-secreting goblet cell subset in the small intestine. PMID: 12681500
  22. AQP9 has a role in osteoclast differentiation, specifically in the fusion process. PMID: 16698796
  23. AQP9 is important for hepatic glycerol metabolism and may play a role in glycerol and glucose metabolism in diabetes mellitus. PMID: 17360690
  24. AQP9 is the major glycerol channel in mouse erythrocytes. PMID: 17636116
  25. Results confirm that AQP9 expression increases during osteoclast biogenesis, but indicate that AQP9 is not essential for osteoclast function or differentiation under normal physiological conditions. PMID: 18666888
  26. The present data provide conclusive evidence for the presence of tetrameric AQP9 in the brain and for the expression of AQP9 in neurons. PMID: 19115411
  27. Blockade of MAPK14/11 negated the increase in Aqp 3 and 9 mRNA levels, whereas culture in a MAPK8 blocker did not, in preimplantation embryos. PMID: 19258345
  28. This study reports on the contribution of AQP9 to the uptake of inorganic arsenite, thereby increasing arsenic-induced cytotoxicity in primary mouse hepatocytes. PMID: 19341753

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin-9 (AQP9) and what is its physiological function in mice?

Aquaporin-9 (AQP9) belongs to the aquaporin family of membrane proteins that facilitate the passage of water and certain solutes across biological membranes. Specifically, AQP9 is classified as an aquaglyceroporin, permitting the transport of water and small neutral solutes, with glycerol being a principal substrate . In mouse physiology, AQP9 plays crucial roles in:

  • Glycerol metabolism, particularly in the liver where it facilitates glycerol uptake for gluconeogenesis

  • Energy balance regulation with implications for metabolic homeostasis

  • Facilitation of glycerol and other small neutral solute transmembrane diffusion

  • Specialized leukocyte functions related to immunological responses and bactericidal activity

Studies have demonstrated that AQP9 expression in mice increases during fasting, correlating with rising plasma glycerol concentration from enhanced lipolysis, and increased glycerol permeability in hepatocyte membranes. Regulation of AQP9 expression is known to depend on insulin in mice and is also influenced by leptin, highlighting its metabolic significance .

In which mouse tissues is AQP9 predominantly expressed?

Mouse AQP9 shows tissue-specific expression patterns that correlate with its physiological functions:

  • Liver: Most prominently expressed in hepatocytes of the liver parenchyma, where it plays a critical role in glycerol uptake for gluconeogenesis

  • Testis and epididymis: Expression has been detected in the columnar epithelium of the epididymis, as confirmed by immunohistochemical staining

  • Brain: Though at lower levels than liver, AQP9 expression has been detected in mouse brain tissue, as demonstrated in western blot analyses of mouse brain membranes

  • Leukocytes: AQP9 may contribute to specialized immune cell functions, reflecting its multifaceted roles beyond metabolism

These expression patterns have been validated through multiple experimental approaches including western blot analysis and immunohistochemical staining, which have confirmed the presence of AQP9 in these tissues .

What are the molecular characteristics of recombinant mouse AQP9?

Recombinant mouse AQP9 has several key molecular characteristics relevant to experimental research:

  • Molecular weight: Approximately 31.3 kDa for the unmodified protein

  • Amino acid composition: Full-length mouse AQP9 consists of 295 amino acids (AA 1-295)

  • Structural features: Forms a transmembrane channel with characteristic hourglass topology typical of aquaporins

  • Functional domains: Contains the NPA (Asparagine-Proline-Alanine) motifs that are critical for water and glycerol transport

  • Post-translational modifications: May include glycosylation and phosphorylation sites that can affect function

When expressed as a recombinant protein, mouse AQP9 is often produced with purification tags such as His-tag, Myc-DYKDDDDK tag, or Strep-tag, which facilitate isolation but may need to be considered in functional studies .

What expression systems are commonly used for producing recombinant mouse AQP9?

Several expression systems have been successfully employed for producing recombinant mouse AQP9, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical PurityCommon Tags
Escherichia coliHigh yield, low cost, rapid productionLimited post-translational modifications>97%His tag
HEK-293 cellsNative-like folding and modificationsHigher cost, lower yield>90%Myc-DYKDDDDK tag, His tag
Cell-free protein synthesisAvoids toxicity issues, rapidLower yield70-80%Strep tag

For most research applications, the choice of expression system depends on the specific experimental requirements:

  • For structural studies requiring large protein quantities, E. coli systems may be preferred

  • For functional studies where proper folding and modifications are critical, mammalian systems like HEK-293 cells offer advantages

  • For rapid screening or when protein toxicity is an issue, cell-free systems provide a viable alternative

The purification process typically involves affinity chromatography using the appropriate tag, followed by additional steps like size exclusion chromatography to achieve high purity levels .

How can the glycerol transport activity of recombinant mouse AQP9 be accurately measured?

Accurate measurement of glycerol transport activity for recombinant mouse AQP9 requires specialized techniques that can detect and quantify the movement of glycerol across membranes. Current methodologies include:

  • Cell-based calcein quenching assays:

    • Cells expressing recombinant mouse AQP9 are loaded with calcein (a self-quenching fluorophore)

    • Exposure to hyperosmotic glycerol solutions causes initial cell shrinkage

    • Subsequent glycerol entry and water influx dilute calcein, increasing fluorescence

    • The rate of fluorescence change correlates with glycerol permeability

    • This approach has been successfully used to determine inhibitor potency, with RG100204 showing an IC50 of ~5 × 10-8 M for glycerol permeability

  • Proteoliposome-based stopped-flow light scattering:

    • Purified recombinant AQP9 is reconstituted into artificial liposomes

    • Proteoliposomes are rapidly mixed with a hyperosmotic glycerol solution

    • Initial water efflux causes liposome shrinkage and increased light scattering

    • Subsequent glycerol influx leads to water influx and decreased light scattering

    • This technique allows direct measurement of glycerol permeability in a defined membrane environment

    • This method can confirm direct channel blocking by inhibitors like RG100204

  • Isotope-labeled glycerol uptake:

    • Quantitative assessment using radiolabeled (14C or 3H) glycerol

    • Allows determination of kinetic parameters (Km, Vmax) through concentration-dependent studies

    • Enables comparison between wild-type and mutant AQP9 variants

For inhibitor studies, these methods can be combined with dose-response experiments to determine IC50 values and characterize inhibition mechanisms .

What are the known inhibitors of mouse AQP9 and their mechanisms of action?

Several compounds have been identified as inhibitors of mouse AQP9, with varying potency, specificity, and mechanisms of action:

  • RG100204:

    • A novel small molecule inhibitor with high potency

    • Blocks both water permeability and glycerol permeability with similar IC50 values (~5 × 10-8 M)

    • More potent than traditional inhibitors like phloretin

    • Acts as a direct blocker of the AQP9 channel, confirmed in proteoliposome studies

    • Has been validated for in vivo experiments, producing dose-dependent elevation of plasma glycerol in mouse models

  • Phloretin:

    • A traditional AQP9 inhibitor with moderate potency

    • Shows IC50 values of ~2 × 10-7 M for water permeability and ~4 × 10-7 M for glycerol permeability

    • Less efficacious than RG100204, with remaining permeability of 16.2% ± 2.6 compared to -1.3% ± 0.4 for RG100204

    • Less specific, affecting multiple membrane transport processes

  • Mercury compounds:

    • Classical inhibitors acting on cysteine residues

    • Non-specific and highly toxic, limiting their research applications

    • Primarily used as experimental controls in mechanistic studies

The mechanism of inhibition generally involves direct interaction with the AQP9 channel structure, limiting the passage of substrates through the pore. Identifying specific, high-potency inhibitors has historically been challenging due to the high sequence similarity between the 13 human aquaporin isoforms and the limited channel surface areas available for inhibitor binding .

How can recombinant mouse AQP9 be used to study hepatic gluconeogenesis pathways?

Recombinant mouse AQP9 provides powerful tools for investigating hepatic gluconeogenesis, especially in relation to glycerol metabolism:

These approaches collectively help elucidate how AQP9-mediated glycerol transport contributes to hepatic glucose production, with implications for understanding metabolic disorders and potential therapeutic interventions .

How does recombinant mouse AQP9 need to be reconstituted for functional studies in artificial membranes?

Functional reconstitution of recombinant mouse AQP9 in artificial membranes is critical for detailed biophysical characterization. The process involves several key steps:

  • Protein preparation:

    • Expression and purification of recombinant mouse AQP9 with >80% purity

    • Careful detergent selection for solubilization (typically n-Dodecyl-β-D-maltoside or n-octyl-β-D-glucopyranoside)

    • Removal of aggregates through size-exclusion chromatography

    • Quantification of protein concentration using established methods

  • Liposome preparation:

    • Selection of appropriate lipid composition (often E. coli polar lipids or synthetic mixtures)

    • Preparation of unilamellar liposomes through extrusion techniques

    • Sizing of liposomes through polycarbonate filters (typically 200-400 nm)

    • Destabilization of liposomes with detergent prior to protein incorporation

  • Reconstitution process:

    • Mixing of purified AQP9 with destabilized liposomes at defined protein-to-lipid ratios

    • Detergent removal through dialysis, bio-beads, or controlled dilution

    • Formation of proteoliposomes containing incorporated AQP9

    • Removal of non-incorporated protein by centrifugation or flotation techniques

  • Functional validation:

    • Confirmation of successful incorporation by freeze-fracture electron microscopy or other imaging techniques

    • Assessment of water and glycerol permeability using stopped-flow light scattering

    • Verification of inhibitor sensitivity with compounds like RG100204

This reconstitution approach has been successfully used for human AQP9 and can be adapted for mouse AQP9, allowing direct measurement of channel properties and inhibitor effects in a controlled membrane environment .

What are the most effective protocols for solubilizing and purifying recombinant mouse AQP9?

Effective solubilization and purification of recombinant mouse AQP9 requires specialized protocols optimized for membrane proteins:

  • Solubilization strategy:

    • Cell lysis: Mechanical disruption (sonication, homogenization) in buffer containing protease inhibitors

    • Membrane isolation: Ultracentrifugation (100,000 × g, 60 minutes)

    • Solubilization buffer: Typically 25 mM Tris-HCl (pH 7.3), 100 mM glycine, with 10% glycerol as a stabilizer

    • Detergent selection: Critical for maintaining protein structure and function

      • Mild detergents like n-Dodecyl-β-D-maltoside (DDM, 1%)

      • n-Octyl-β-D-glucopyranoside (OG, 3-4%)

    • Incubation: 2-4 hours at 4°C with gentle agitation

    • Removal of insoluble material: Centrifugation (100,000 × g, 30 minutes)

  • Affinity purification (for tagged AQP9):

    • Column selection based on tag (Ni-NTA for His-tagged proteins, anti-FLAG for DYKDDDDK-tagged proteins)

    • Equilibration with solubilization buffer containing detergent

    • Sample loading at slow flow rate to maximize binding

    • Washing with increasing imidazole concentrations (20-40 mM) to remove non-specific binding

    • Elution with high imidazole (250-500 mM) or specific peptides for epitope tags

  • Additional purification steps:

    • Size exclusion chromatography to remove aggregates and achieve >90% purity

    • Optional ion exchange chromatography for higher purity requirements

    • Concentration using appropriate molecular weight cutoff filters

    • Buffer exchange to remove imidazole and adjust final storage conditions

Following this protocol, recombinant mouse AQP9, from system yield and purity levels typically range from >80% for standard preparations to >97% for more extensive purification schemes, as determined by SDS-PAGE and Coomassie blue staining .

How can functional recombinant mouse AQP9 be distinguished from non-functional protein?

Distinguishing functional from non-functional recombinant mouse AQP9 is critical for experimental reliability. Multiple complementary approaches should be employed:

  • Functional assays:

    • Water/glycerol permeability measurements in proteoliposomes using stopped-flow techniques

    • Cell-based permeability assays using calcein quenching methodology

    • Inhibitor response testing: Functional AQP9 should show characteristic inhibition by compounds like RG100204 with expected IC50 values (~5 × 10-8 M)

    • Comparison with known functional standards and negative controls

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Thermal stability assays (differential scanning fluorimetry)

    • Limited proteolysis patterns (properly folded proteins often show resistance to digestion)

    • Size exclusion chromatography to detect aggregation or inappropriate oligomerization

  • Comparative analysis:

    • Side-by-side comparison with native AQP9 from tissue sources

    • Functional rescue experiments in AQP9-deficient systems

    • Mutagenesis of key residues known to affect function as internal controls

  • Microscopy techniques:

    • Fluorescence microscopy of tagged constructs to assess proper membrane localization

    • Electron microscopy of reconstituted proteoliposomes to confirm incorporation

These approaches provide complementary information about protein quality and functionality. Non-functional protein typically exhibits aggregation, improper folding, or significantly reduced permeability to characteristic substrates like glycerol. By employing multiple methods, researchers can confidently distinguish functional recombinant AQP9 for subsequent experimental applications .

What are the common challenges in expressing recombinant mouse AQP9 and how can they be overcome?

Expressing recombinant mouse AQP9 presents several challenges typical of membrane proteins. Common issues and solutions include:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Test different promoter strengths and induction conditions

      • Consider specialized expression strains designed for membrane proteins

      • Implement low-temperature induction (18-25°C) to allow proper folding

      • For mouse AQP9, HEK-293 cells have proven effective for producing functional protein

  • Protein misfolding and aggregation:

    • Challenge: Complex membrane topology can lead to misfolding

    • Solutions:

      • Include chemical chaperones in growth media (glycerol, specific osmolytes)

      • Co-express with molecular chaperones in applicable systems

      • Carefully optimize induction parameters (concentration, duration, temperature)

      • Select appropriate detergents for extraction that maintain native structure

  • Toxicity to host cells:

    • Challenge: Overexpression of membrane proteins can disrupt host cell membranes

    • Solutions:

      • Use tightly regulated expression systems to control protein production

      • Consider cell-free protein synthesis systems which avoid toxicity issues

      • Implement auto-induction media for gradual protein production

      • Cell-free protein synthesis has been successfully used for mouse AQP9 with 70-80% purity

  • Poor solubilization and extraction:

    • Challenge: Efficient extraction from membranes without denaturation

    • Solutions:

      • Screen multiple detergents at various concentrations

      • Include stabilizing agents like glycerol (10%) in extraction buffers

      • Optimize solubilization time, temperature, and buffer composition

      • Established protocols typically use Tris-HCl buffer (pH 7.3) with glycine and glycerol

  • Limited stability after purification:

    • Challenge: Maintaining functional stability during storage

    • Solutions:

      • Store at -80°C in single-use aliquots to prevent freeze-thaw damage

      • Limit freeze-thaw cycles to 2-3 maximum

      • Include stabilizing additives in storage buffers (typically 10% glycerol)

      • Under optimal conditions, recombinant AQP9 can maintain stability for 12 months

For mouse AQP9 specifically, both mammalian expression systems (for highest functionality) and bacterial systems (for highest yield) have been successfully employed, with the choice depending on the specific experimental requirements .

How can antibody specificity be validated when working with recombinant mouse AQP9?

Validating antibody specificity is crucial when working with recombinant mouse AQP9 to ensure reliable experimental results. A comprehensive validation approach includes:

  • Positive and negative controls:

    • Use purified recombinant mouse AQP9 as a positive control

    • Include non-expressing tissues or cells as negative controls

    • Compare results from multiple antibodies targeting different epitopes

    • Western blot analysis of tissues with known expression patterns (liver, brain, testis) can establish baseline specificity

  • Blocking peptide validation:

    • Pre-incubate antibody with the immunizing peptide

    • Compare results with and without peptide blocking

    • Specific signals should be abolished or significantly reduced by peptide competition

    • This approach has been successfully demonstrated for anti-AQP9 antibodies in rat tissue samples

  • Genetic models:

    • Test antibodies in AQP9 knockout tissues or cells

    • Compare with heterozygous and wild-type samples

    • Specific signals should be absent in knockout samples

  • Cross-reactivity assessment:

    • Test against other aquaporin family members (especially other aquaglyceroporins)

    • Evaluate potential cross-reactivity with closely related proteins

    • Ensure the antibody doesn't recognize the purification tag when using tagged recombinant AQP9

  • Multiple detection methods:

    • Compare results across techniques (Western blot, immunohistochemistry, immunofluorescence)

    • Consistent patterns across methods support specificity

    • Documented examples show consistent AQP9 detection in hepatocytes and epididymal epithelium using validated antibodies

As demonstrated in previously published work, properly validated antibodies show specific staining in expected tissues like liver hepatocytes and epididymal epithelium, with signals that can be blocked by pre-incubation with the immunizing peptide .

How should discrepancies between in vitro recombinant mouse AQP9 data and in vivo observations be reconciled?

Reconciling discrepancies between in vitro recombinant mouse AQP9 data and in vivo observations requires careful consideration of multiple factors:

  • System complexity differences:

    • In vitro systems lack the regulatory networks present in vivo

    • Post-translational modifications may differ between recombinant and native AQP9

    • Membrane composition significantly affects AQP9 function and differs between artificial and cellular membranes

    • Consider whether the experimental system adequately represents physiological conditions

  • Methodological considerations:

    • Evaluate whether in vitro assay conditions reflect physiological parameters

    • Assess if protein concentration and orientation in reconstituted systems match in vivo conditions

    • Consider the impact of tags and fusion partners on protein function

    • Compare data from multiple experimental approaches to identify system-specific artifacts

  • Biological context factors:

    • AQP9 functions within complex metabolic pathways in vivo with multiple feedback mechanisms

    • Regulatory factors (hormonal control, protein-protein interactions) present in vivo may be absent in vitro

    • Mouse models used for in vivo studies (e.g., db/db mice) have metabolic abnormalities that may influence results

  • Reconciliation strategies:

    • Establish clear correlations between in vitro properties and in vivo phenotypes

    • Use AQP9 knockout models as negative controls for validation

    • Develop more complex reconstitution systems that better mimic physiological conditions

    • Consider intermediary approaches (cell-based systems) that bridge the gap between purified proteins and whole organisms

For example, the AQP9 inhibitor RG100204 showed clear effects on glycerol permeability in vitro and corresponding elevation of plasma glycerol in vivo, but its blood glucose-lowering effect was not statistically significant in animal models . This discrepancy likely reflects the complexity of glucose homeostasis beyond simple glycerol availability.

What are the appropriate statistical methods for analyzing permeability data from recombinant mouse AQP9 experiments?

Appropriate statistical analysis is essential for interpreting permeability data from recombinant mouse AQP9 experiments:

  • For dose-response inhibition studies:

    • Nonlinear regression analysis to calculate IC50 values

    • Four-parameter logistic model (Hill equation) to fit dose-response curves

    • 95% confidence intervals should be reported alongside IC50 values

    • Example: Analysis of RG100204 inhibition yielded IC50 values of ~5 × 10-8 M for both water and glycerol permeability

  • For comparative permeability measurements:

    • Paired or unpaired t-tests for simple two-group comparisons

    • ANOVA with appropriate post-hoc tests (Tukey, Bonferroni) for multiple group comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

    • Report both statistical significance (p-values) and effect sizes

  • For time-course experiments:

    • Curve fitting to appropriate kinetic models (single or multi-exponential)

    • Extraction of rate constants for comparison between conditions

    • Repeated measures ANOVA for comparing multiple time points

  • For reproducibility assessment:

    • Calculate coefficients of variation (CV) within and between experiments

    • Perform power analysis to determine appropriate sample sizes

    • Consider Bland-Altman plots for method comparison studies

  • Data reporting guidelines:

    • Always include error bars representing standard deviation or standard error

    • Clearly indicate sample sizes (n) for all experiments

    • Present individual data points alongside means when feasible

    • Specify the statistical tests used and significance thresholds

A typical reporting format for AQP9 inhibitor studies would include IC50 values with 95% confidence intervals, and remaining permeability percentages with standard errors, as demonstrated in published comparisons of RG100204 vs. phloretin (remaining permeability -1.3% ± 0.4 vs. 16.2% ± 2.6) .

What controls should be included in functional assays using recombinant mouse AQP9?

Robust experimental design for recombinant mouse AQP9 functional assays requires comprehensive controls:

  • Expression system controls:

    • Non-transfected/mock-transfected cells or liposomes without AQP9

    • Systems expressing an unrelated membrane protein of similar size

    • Empty vector controls for all expression constructs

    • Research has demonstrated the importance of comparing AQP9-expressing CHO cells with control CHO cells lacking AQP9 expression

  • Protein quality controls:

    • Heat-denatured recombinant AQP9 as a negative control

    • Known functional AQP9 preparation as a positive standard

    • Inclusion of AQP9 mutants with defined functional defects

    • Batch-to-batch consistency controls for long-term studies

  • Assay-specific controls:

    • For permeability assays:

      • Measurement of baseline permeability in control systems

      • Inclusion of known inhibitors like phloretin as positive controls

      • Temperature controls to distinguish between facilitated and passive diffusion

      • In calcein quenching assays, background fluorescence and quenching controls

    • For stopped-flow measurements:

      • Buffer-only controls to account for mixing artifacts

      • Osmotic gradient controls without permeable solutes

      • Technical replicates to ensure instrument consistency

  • Specificity controls:

    • Tests with other aquaporin family members, particularly other aquaglyceroporins

    • Comparison with established inhibitor profiles

    • Dose-response relationships to confirm specific binding

    • For example, comparison of RG100204 with phloretin demonstrated more potent and efficacious inhibition of AQP9

  • Validation controls:

    • Independent measurement techniques to confirm findings

    • Correlation between different functional parameters (water vs. glycerol permeability)

    • Comparison of results in different expression systems or membrane environments

Implementing these controls enables proper interpretation of experimental data and increases confidence in the specificity and relevance of findings related to recombinant mouse AQP9 function.

How can recombinant mouse AQP9 be used in drug discovery and development?

Recombinant mouse AQP9 provides valuable tools for drug discovery and therapeutic development:

  • High-throughput screening platforms:

    • Development of cell-based assays using stable AQP9-expressing lines

    • Fluorescence-based readouts (calcein quenching) for automated screening

    • Adaptation of proteoliposome systems for compound library evaluation

    • Identification of novel inhibitors with improved specificity and potency compared to existing compounds like RG100204

  • Structure-activity relationship studies:

    • Systematic modification of lead compounds to optimize potency

    • Correlation of inhibitor structures with functional effects on recombinant AQP9

    • Computational modeling of inhibitor binding to the AQP9 channel

    • Design of species-specific inhibitors based on structural differences between mouse and human AQP9

  • Therapeutic target validation:

    • Use of recombinant AQP9 and specific inhibitors to validate its role in metabolic pathways

    • Correlation of in vitro inhibitor potency with in vivo metabolic effects

    • Assessment of AQP9 inhibition on glycerol metabolism and gluconeogenesis

    • Exploration of AQP9 as a potential target for metabolic disorders based on its role in glycerol homeostasis

  • Biomarker development:

    • Recombinant AQP9 as a standard for quantitative assays

    • Development of specific antibodies and detection methods

    • Correlation of AQP9 levels with disease states and treatment responses

    • Investigation of AQP9's multifaceted roles in health and disease as potential biomarkers

The high potency and specificity of newly identified inhibitors like RG100204 (IC50 ~5 × 10-8 M) demonstrate significant progress in targeting AQP9, enabling more detailed investigation of its role in physiological and pathological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.