Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please specify your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please let us know, and we will prioritize its inclusion.
Synonyms
Asgr2; Asgr-2; Asialoglycoprotein receptor 2; ASGP-R 2; ASGPR 2; Hepatic lectin 2; HL-2; mHL-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLSLLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Uniprot No.

Target Background

Function
This protein mediates the endocytosis of plasma glycoproteins that have undergone removal of the terminal sialic acid residue on their complex carbohydrate moieties. It recognizes terminal galactose and N-acetylgalactosamine units. Following ligand binding to the receptor, the complex is internalized and transported to a sorting organelle where receptor and ligand are separated. The receptor then returns to the cell membrane surface.
Gene References Into Functions
  1. ASGP-R2 facilitates the clearance of glycoproteins bearing oligosaccharides terminating with Siaalpha2,6Gal, thereby contributing to the maintenance of their relative concentrations in the bloodstream. PMID: 19075021
Database Links

KEGG: mmu:11890

STRING: 10090.ENSMUSP00000099632

UniGene: Mm.1357

Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed exclusively in hepatic parenchymal cells.

Q&A

What is mouse ASGR2 and how does it differ from ASGR1?

Mouse ASGR2 (also known as hepatic lectin 2 or HL-2) is an approximately 38 kDa C-type lectin receptor family member that functions as a component of the asialoglycoprotein receptor (ASGPR). Structurally, ASGR2 is about 2 kDa larger than ASGR1, though they are encoded by distinct but closely linked genes. The mature ASGR2 protein consists of a cytoplasmic domain, transmembrane segment, and an extracellular domain (ECD). Mouse ASGR2 shares 67% amino acid sequence identity with human ASGR2 and 83% with rat ASGR2 . Both ASGR1 and ASGR2 form the heterooligomeric ASGPR complex that is primarily responsible for the endocytosis and clearance of desialylated glycoproteins from circulation.

What are the primary biological functions of mouse ASGR2?

Mouse ASGR2 collaborates with ASGR1 to form the asialoglycoprotein receptor, which mediates removal of potentially hazardous glycoconjugates from blood in both health and disease conditions. Specifically, ASGR2 plays critical roles in:

  • Endocytosis of desialylated glycoproteins

  • Regulation of hepatic thrombopoietin production

  • Modulation of von Willebrand factor (vWF) and platelet homeostasis

  • Clearance of platelets that undergo desialylation during sepsis caused by pathogens (e.g., S. pneumoniae)

Recent research also suggests that glycoproteins bearing terminal Siaα2,6GalNAc and Siaα2,6Gal moieties may serve as endogenous ligands for the ASGP-R complex, contributing to the regulation of glycoprotein half-life in circulation .

How should recombinant mouse ASGR2 Fc chimera protein be reconstituted for optimal activity?

For optimal biological activity, recombinant mouse ASGR2 Fc chimera protein should be reconstituted at a concentration of 500 μg/mL in PBS. The process should be performed carefully to avoid protein denaturation:

  • Allow the lyophilized protein to equilibrate to room temperature (20-25°C)

  • Add the appropriate volume of sterile PBS to achieve the 500 μg/mL concentration

  • Gently swirl or rotate the vial until complete dissolution (avoid vigorous shaking or vortexing)

  • Allow the solution to sit for 5-10 minutes at room temperature

  • For long-term storage, prepare working aliquots to avoid repeated freeze-thaw cycles

Note that carrier-free versions (without BSA) are recommended for applications where the presence of BSA might interfere with experimental outcomes.

What binding affinity does recombinant mouse ASGR2 demonstrate toward key ligands?

Recombinant mouse ASGR2 Fc chimera exhibits specific binding affinities to various ligands. When immobilized, it binds human plasma von Willebrand Factor with an ED50 of 0.05-0.6 μg/mL . This binding property is crucial for researchers studying platelet homeostasis and thrombosis models. The protein's lectin domain facilitates calcium-dependent recognition of terminal galactose and N-acetylgalactosamine residues on desialylated glycoproteins.

Affinity data for mouse ASGR2 binding can be summarized in the following table:

LigandBinding Affinity (ED50)Method of Detection
Human plasma vWF0.05-0.6 μg/mLSurface binding assay
Desialylated glycoproteinsVariable (nM range)Cellular uptake assays
Asialofetuin1-10 nMCompetition binding

How does ASGR2 interact with ASGR1 to modulate platelet homeostasis and vWF clearance?

The interaction between ASGR2 and ASGR1 in regulating platelet homeostasis involves multiple molecular mechanisms. ASGPR (composed of both ASGR1 and ASGR2) can modulate von Willebrand factor and platelet homeostasis partly through clearance of desialylated platelets during sepsis caused by pathogens like S. pneumoniae.

Research indicates that while ASGR1 participates in plasma vWF clearance independently of sialylation and sepsis conditions, ASGR2 demonstrates increased colocalization with plasma vWF in ASGR1-deficient mouse models . This suggests a compensatory mechanism where ASGR2 may play a more prominent role in vWF clearance when ASGR1 function is compromised.

To investigate this interaction experimentally:

  • Generate ASGR1/ASGR2 single and double knockout mouse models

  • Compare platelet counts and vWF levels across genotypes

  • Challenge with desialylating agents or pathogens that cause desialylation

  • Perform co-immunoprecipitation experiments to detect physical interactions

  • Use fluorescently labeled vWF to track clearance kinetics in vivo

What is the role of ASGR2 in hepatic thrombopoietin production and how can this be studied?

ASGR2 contributes to hepatic thrombopoietin (TPO) production through mechanisms that may involve sensing or responding to platelet clearance signals. To investigate this function:

  • In vitro hepatocyte culture system:

    • Isolate primary mouse hepatocytes from wild-type and ASGR2-deficient mice

    • Treat cultures with desialylated platelets or glycoproteins

    • Measure TPO mRNA expression using qRT-PCR

    • Quantify secreted TPO using ELISA

  • In vivo approaches:

    • Generate liver-specific ASGR2 knockout mice

    • Challenge with thrombocytopenic agents

    • Monitor platelet recovery kinetics

    • Measure serum TPO levels at defined intervals

    • Assess hepatic TPO mRNA expression

  • Mechanistic investigations:

    • Identify signaling pathways activated downstream of ASGR2 engagement

    • Determine if JAK/STAT pathway components are modulated by ASGR2 activation

    • Investigate whether ASGR2-mediated endocytosis is required for TPO regulation

What are the critical quality control parameters for recombinant mouse ASGR2 protein preparations?

Quality control for recombinant mouse ASGR2 preparations should assess multiple parameters to ensure experimental reproducibility:

  • Purity assessment:

    • SDS-PAGE under reducing and non-reducing conditions should show bands at 62-81 kDa and 120-160 kDa, respectively

    • Purity should exceed 90% as determined by densitometric analysis

  • Functional verification:

    • Binding assays with known ligands (e.g., vWF)

    • Lectin activity assays using desialylated glycoprotein substrates

  • Structural integrity:

    • Circular dichroism spectroscopy to verify secondary structure

    • Size-exclusion chromatography to confirm absence of aggregates

  • Endotoxin testing:

    • LAL assay to ensure preparations contain <1.0 EU/μg protein

  • Glycosylation analysis:

    • Mass spectrometry to verify appropriate post-translational modifications

    • Lectin blots to confirm glycan composition

How can researchers effectively detect ASGR2 expression and localization in mouse tissue samples?

Multiple complementary approaches can be used to detect ASGR2 expression and localization in mouse tissues:

  • Immunohistochemistry (IHC):

    • Use validated anti-ASGR2 antibodies on formalin-fixed paraffin-embedded sections

    • Include positive control (liver) and negative control (spleen) tissues

    • Optimize antigen retrieval methods (citrate buffer pH 6.0 generally works well)

    • Counter-stain with hematoxylin to visualize tissue architecture

  • Immunofluorescence:

    • Co-staining with markers for subcellular compartments (e.g., early endosomes, plasma membrane)

    • Confocal microscopy to assess colocalization with ASGR1 or potential ligands

  • Western blotting:

    • Tissue lysate preparation should include membrane solubilization

    • Expected molecular weight: ~38 kDa for native ASGR2

  • qRT-PCR:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Normalize to stable reference genes (e.g., GAPDH, β-actin)

What factors might affect the binding capacity of recombinant mouse ASGR2 in experimental systems?

Several factors can influence ASGR2 binding capacity in experimental systems:

  • Calcium dependency:

    • ASGR2 binding requires physiological calcium concentrations (1-2 mM)

    • Ensure buffers contain appropriate Ca²⁺ levels

    • EDTA or EGTA will abolish binding activity

  • pH sensitivity:

    • Optimal binding occurs at pH 7.2-7.4

    • Acidic pH (<6.5) disrupts ligand interactions

    • Buffer composition should maintain physiological pH

  • Glycosylation status:

    • Both ASGR2 and its ligands require specific glycosylation patterns

    • Expression systems (bacterial vs. mammalian) affect glycosylation

    • Verify glycosylation status of recombinant proteins

  • Storage conditions:

    • Repeated freeze-thaw cycles reduce activity

    • Protein aggregation diminishes binding capacity

    • Maintain storage at -80°C in small aliquots

  • Steric hindrance:

    • Tag position (N- vs C-terminal) may affect binding site accessibility

    • Consider using tag-free proteins for crucial experiments

How can contradictory data in ASGR2 functional studies be reconciled?

When faced with contradictory data in ASGR2 functional studies, consider the following analytical approaches:

  • Experimental system variations:

    • Cell types used (primary hepatocytes vs. cell lines)

    • Species differences (mouse vs. human ASGR2 shares only 67% identity)

    • In vitro vs. in vivo models (compensatory mechanisms may exist in vivo)

  • Isoform considerations:

    • Alternative splicing generates multiple ASGR2 variants

    • Verify which splice variant is being studied

    • Different isoforms may have distinct functional properties

  • Hetero-oligomeric complexes:

    • ASGR2:ASGR1 stoichiometry affects receptor function

    • Expression levels of each component may vary across systems

    • Co-expression of both receptor components may be necessary

  • Physiological context:

    • Inflammatory state alters ASGR2 function

    • Hormonal regulation may differ between experimental models

    • Presence of competitive ligands in serum-containing media

  • Methodological resolution:

    • Standardize ligand concentrations and preparation

    • Use multiple complementary techniques to confirm findings

    • Consider temporal aspects (acute vs. chronic effects)

What emerging technologies might advance our understanding of mouse ASGR2 function?

Several cutting-edge technologies hold promise for expanding our understanding of ASGR2 biology:

  • CRISPR-Cas9 genome editing:

    • Generation of precise point mutations to identify critical residues

    • Domain-specific deletions to determine functional regions

    • Knock-in of reporter tags for live-cell imaging

  • Cryo-electron microscopy:

    • Structural determination of ASGR1/ASGR2 heterooligomeric complexes

    • Visualization of ligand-receptor interactions at atomic resolution

    • Conformational changes upon ligand binding

  • Single-cell transcriptomics:

    • Identification of cell populations expressing ASGR2

    • Understanding heterogeneity of expression within tissues

    • Temporal regulation during development or disease progression

  • Glycomics approaches:

    • Comprehensive analysis of glycan structures recognized by ASGR2

    • Lectin array technologies to determine binding specificities

    • Synthetic glycobiology to engineer novel ligands

  • Intravital microscopy:

    • Real-time visualization of ASGR2-mediated endocytosis in vivo

    • Tracking of labeled ligand clearance in animal models

    • Dynamic interaction with other cellular components

How might mouse ASGR2 research translate to understanding human disease conditions?

Mouse ASGR2 research has significant translational potential for human disease:

  • Thrombotic disorders:

    • ASGR2's role in vWF and platelet homeostasis suggests potential therapeutic targets

    • Modulators of ASGR2 function might regulate thrombosis risk

    • Diagnostic potential in predicting thrombotic events

  • Sepsis management:

    • ASGR2 mediates clearance of desialylated platelets during sepsis

    • Monitoring ASGR2 activity might predict sepsis severity

    • Therapeutic targeting to prevent thrombocytopenia during infection

  • Cancer biomarkers:

    • ASGR2 expression correlates with malignant phenotypes in gastric cancer

    • Potential biomarker for recurrence in specific cancer types

    • Altered glycosylation in cancer may affect ASGR2-mediated clearance

  • Liver disease:

    • Changes in ASGR2 expression or function during liver injury

    • Potential role in regenerative responses

    • Biomarker for hepatic function assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.