Recombinant Mouse Atlastin-2 (Atl2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atl2; Arl6ip2; Atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; Aip-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Atl2
Target Protein Sequence
MAEGDEAARRQQPQQGLRRRRQTSDSSVGVNHVSSTTSLGEDYEDDDLVNSDEVMKKPCP VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYN KDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDS QSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLM FLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPG LKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYI KIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLD LKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFA VMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAET LWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
Uniprot No.

Target Background

Function
Atlastin-2 (ATL2) is a GTPase that tethers membranes through the formation of trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.
Gene References Into Functions
  1. Endoplasmic reticulum morphology is significantly disrupted in ATL1, ATL2, and ATL3 knockout cells. PMID: 27669642
Database Links

KEGG: mmu:56298

UniGene: Mm.175403

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of Atlastin-2 in mouse cells?

Atlastin-2 is a GTPase that catalyzes endoplasmic reticulum membrane fusion, playing a crucial role in maintaining the branched network structure of the ER. Like human ATL1 and ATL2, mouse Atlastin-2 mediates the fusion of ER membranes, which is essential for proper ER morphology and function . Research has shown that purified atlastins are capable of fusion catalysis, but interestingly, the major splice isoforms are subject to autoinhibition that regulates their activity . Mouse Atlastin-2 contains conserved domains including a GTPase domain, a middle region, and C-terminal transmembrane domains, similar to its human homolog.

How does mouse Atlastin-2 differ from human ATL2?

While mouse and human Atlastin-2 share significant homology and functional parallels, there are species-specific differences in expression patterns, splice variants, and potentially in regulatory mechanisms. Both mouse and human ATL2 demonstrate autoinhibition mediated by C-terminal domains, with studies showing that the C-terminal extensions share moderate conservation across vertebrates despite lacking sequence similarity between different atlastin family members . Specific sequence variations in the inhibitory domain may result in different degrees of autoinhibition between species. For neuronal expression specifically, both humans and mice express particular splice isoforms with modifications in the inhibitory domain that show higher fusion activity .

What are the known splice variants of mouse Atlastin-2 and their significance?

Similar to human ATL2, mouse Atlastin-2 has multiple splice variants with different functional properties. Research on human ATL2 has shown that neurons express a specific splice isoform with sequence differences in the inhibitory domain, resulting in full fusion activity compared to the more strongly inhibited canonical form . This suggests that mouse neurons likely express similar specialized variants optimized for neural tissue requirements. The differential expression of these splice variants allows for tissue-specific regulation of ER membrane fusion activity, with neuronal isoforms potentially showing enhanced fusion capacity compared to those expressed in other tissues.

What molecular mechanisms regulate mouse Atlastin-2 fusion activity?

Mouse Atlastin-2, like its human counterpart, is regulated through autoinhibition mechanisms centered on its C-terminal domain. Detailed studies of human ATL2 have revealed that autoinhibition maps to a C-terminal α-helix that is predicted to be continuous with an amphipathic helix required for fusion . Serial C-terminal truncation experiments demonstrated that removal of specific amino acid sequences (such as AA569-573 and AA554-565 in human ATL2) can increase fusion rates by 6-10 fold . The inhibitory mechanism involves the C-terminal extension interfering with the fusion-promoting function of the amphipathic helix. Additionally, charge reversal mutations of residues in the inhibitory domain can strongly activate fusion activity, suggesting electrostatic interactions play a key role in the autoinhibition . These regulatory principles likely apply to mouse Atlastin-2 as well, with possibly species-specific variations in the exact residues involved.

How do mutations in mouse Atlastin-2 affect ER morphology and cellular function?

Mutations in Atlastin-2 can severely disrupt ER network morphology and cellular homeostasis. Studies have shown that overexpression of disinhibited versions of human ATL2 (with mutations in the inhibitory domain) caused ER collapse, highlighting the critical importance of proper regulation of fusion activity . For mouse Atlastin-2, mutations that affect GTPase activity, membrane association, or the autoinhibitory mechanism would similarly disrupt ER morphology. The resulting alterations in ER structure can impair protein folding, lipid metabolism, and calcium homeostasis, leading to ER stress and potential activation of the unfolded protein response. In neuronal cells, which express specific splice variants of Atlastin-2 with enhanced fusion activity, mutations may have particularly severe consequences for neuronal function and survival.

What is the relationship between mouse Atlastin-2 and lipid metabolism?

Atlastin-2 plays an important role in lipid metabolism, particularly in the formation of lipid droplets. Research has specifically identified that ATL2 is necessary for lipid droplet formation in murine breast tissue . This function connects Atlastin-2 to cellular energy storage and lipid homeostasis. The mechanism likely involves Atlastin-2's role in shaping the ER network, which is intimately involved in lipid synthesis and the biogenesis of lipid droplets. Dysregulation of Atlastin-2 expression or function could therefore impact cellular lipid storage and metabolism, with potential implications for conditions involving altered lipid handling, such as metabolic disorders or cancer. The association between ATL2 expression and cancer progression may be partially mediated through these effects on lipid metabolism .

What are the best approaches for studying recombinant mouse Atlastin-2 fusion activity in vitro?

To study mouse Atlastin-2 fusion activity in vitro, researchers should consider implementing liposome fusion assays similar to those successfully used for human atlastins. The protocol typically involves:

  • Protein purification: Express and purify full-length mouse Atlastin-2 or specific splice variants with appropriate tags for purification while maintaining functional integrity.

  • Liposome preparation: Create donor and acceptor liposomes with lipid compositions mimicking the ER membrane. Donor liposomes can be labeled with fluorescent lipids such as NBD-PE and rhodamine-PE for FRET-based fusion assays.

  • Fusion assay setup: Mix the labeled donor liposomes with unlabeled acceptor liposomes in the presence of purified Atlastin-2 and GTP.

  • Detection: Monitor fusion by measuring either lipid mixing (through FRET) or content mixing over time.

This method has been successfully employed with human atlastins, revealing that the major splice isoforms of ATL1 and ATL2 are autoinhibited . When designing truncation or mutation studies, focus on the C-terminal region, particularly sequences analogous to human ATL2 residues 569-573 and 554-565, which significantly affect fusion rates when deleted .

How can researchers accurately detect and quantify different mouse Atlastin-2 splice variants?

For accurate detection and quantification of mouse Atlastin-2 splice variants, researchers should employ a combination of techniques:

  • RT-qPCR with isoform-specific primers/probes: Design primers that span unique exon junctions in each splice variant. For example, in studying human ATL2-2, researchers used a probe spanning exons 12 and 13a for specificity . For mouse variants, similar approaches targeting unique exon combinations should be employed.

  • RNA-Seq analysis: This provides comprehensive detection of all expressed splice variants and their relative abundances. Computational analysis should focus on exon-level expression rather than just gene-level expression.

  • Western blotting with isoform-specific antibodies: Where possible, develop or obtain antibodies that specifically recognize unique epitopes in different splice variants.

  • RNAscope in situ hybridization: For tissue localization studies, the RNAscope technique provides high sensitivity and specificity for detecting specific mRNA variants, as demonstrated in studies of other membrane proteins .

For quantification, use appropriate reference genes (such as TATA-binding protein) for normalization in qPCR experiments . When analyzing expression patterns across tissues, it's crucial to verify the specificity of detection methods, as splice variants may differ by only small sequence regions.

What experimental approaches can determine the role of mouse Atlastin-2 in disease models?

To investigate mouse Atlastin-2's role in disease models, researchers should consider these methodological approaches:

  • Genetic manipulation models:

    • Generate conditional knockout mice for tissue-specific deletion of Atlastin-2

    • Create knock-in mice expressing specific splice variants or mutations

    • Use CRISPR/Cas9 for introducing specific mutations related to autoinhibition

  • Disease-specific assays:

    • For cancer studies: Analyze ATL2 expression in tumor vs. normal tissue and correlate with clinical outcomes, similar to studies showing ATL2-2 association with breast cancer prognosis

    • For neurological disorders: Assess neuronal morphology, function, and survival in models with altered Atlastin-2 function

    • For metabolic disorders: Evaluate lipid droplet formation and metabolism in tissues with modified Atlastin-2 expression

  • Pathway analysis:

    • Perform RNA-Seq or proteomics to identify altered pathways when Atlastin-2 function is modified

    • Focus on hallmark pathways like MYC targets, E2F targets, and G2M checkpoint genes that have been associated with high ATL2 expression in cancer studies

  • Therapeutic intervention testing:

    • Design experiments to test whether modulating Atlastin-2 activity affects disease progression

    • Consider both inhibition approaches for conditions where ATL2 overexpression is detrimental, and enhancement strategies where function is compromised

When designing these studies, it's crucial to account for the tissue-specific expression of different splice variants and to include appropriate controls for distinguishing between effects specific to Atlastin-2 versus general disruption of ER morphology.

How should researchers interpret changes in mouse Atlastin-2 expression levels in different experimental conditions?

When interpreting changes in mouse Atlastin-2 expression levels, researchers should:

  • Consider splice variant specificity: Different splice variants may have opposing functions or varying degrees of activity. For example, in humans, neuronal ATL2 splice isoforms show full fusion activity while canonical forms are autoinhibited . Therefore, measure specific variants rather than total Atlastin-2 whenever possible.

  • Analyze relative expression: Compare Atlastin-2 levels to appropriate housekeeping genes like TATA-binding protein (TBP) . Log2 transformation of expression data may be necessary for normalization before statistical analysis.

  • Correlate with ER morphology: Changes in Atlastin-2 expression should be interpreted alongside observations of ER network structure, as altered fusion activity directly impacts ER morphology. Disinhibited versions of ATL2 can cause ER collapse when overexpressed .

  • Examine context-dependent effects: The same expression change may have different consequences in different tissues due to varying requirements for ER fusion activity. For instance, neurons express specific splice variants , suggesting unique requirements for Atlastin-2 function in neural tissue.

  • Consider connections to disease pathways: In cancer contexts, high ATL2 expression has been associated with upregulation of MYC targets, E2F targets, and G2M checkpoint genes , suggesting interaction with key cancer driver pathways.

What are the most common pitfalls in analyzing mouse Atlastin-2 function and how can they be avoided?

Common pitfalls in analyzing mouse Atlastin-2 function include:

  • Failing to distinguish between splice variants: Different variants have distinct activities and expression patterns. Solution: Use isoform-specific primers/probes for RT-qPCR and antibodies that can differentiate between variants .

  • Overexpression artifacts: Excessive expression can cause non-physiological effects like ER collapse . Solution: Use controlled expression systems and include wild-type controls; consider knockin approaches that maintain physiological expression levels.

  • Incomplete assessment of fusion activity: Relying solely on GTPase activity or protein interaction assays without directly measuring membrane fusion. Solution: Combine in vitro fusion assays with structural studies and cellular ER morphology analysis.

  • Ignoring the autoinhibitory mechanism: Mutations or truncations may inadvertently affect the autoinhibitory domain, leading to misinterpretation of results. Solution: Carefully design mutations with knowledge of the inhibitory regions, such as the C-terminal α-helix in ATL2 .

  • Limited tissue context: Extrapolating findings from one cell type to others without considering tissue-specific expressions. Solution: Verify findings across relevant cell types, particularly comparing neuronal and non-neuronal contexts where splice variant expression differs .

  • Inadequate controls in disease models: Not accounting for general ER stress effects versus specific Atlastin-2 functions. Solution: Include controls that cause comparable ER stress through different mechanisms to isolate Atlastin-2-specific effects.

How can researchers reconcile contradictory data about mouse Atlastin-2 function from different experimental approaches?

When faced with contradictory data about mouse Atlastin-2 function from different experimental approaches, researchers should:

  • Examine splice variant differences: Contradictions may arise from studying different splice variants with distinct regulatory mechanisms. For example, neuronal ATL2 variants show full fusion activity while canonical forms are autoinhibited .

  • Consider experimental context: In vitro reconstitution studies may yield different results than cellular or in vivo studies due to the absence of regulatory partners or physiological membrane environments.

  • Evaluate protein expression levels: Different expression levels may yield contradictory results, especially considering the dose-dependent effects of fusion proteins on ER morphology. Disinhibited ATL2 can cause ER collapse when overexpressed .

  • Analyze technical differences in fusion assays: Variations in liposome composition, protein purification methods, or detection systems can affect measured fusion activities. Standardize these parameters when comparing across studies.

  • Apply multiple complementary techniques: To resolve contradictions, apply orthogonal approaches:

    • Combine in vitro fusion assays with cellular ER morphology studies

    • Use both loss-of-function (knockout/knockdown) and gain-of-function (overexpression) approaches

    • Correlate structural studies with functional assays

  • Consider species-specific differences: When comparing to human ATL2 studies, note that while core functions are conserved, regulatory mechanisms may vary between species, particularly in the inhibitory domains that show moderate cross-species conservation .

What are the most promising therapeutic applications of mouse Atlastin-2 research?

Based on current understanding, the most promising therapeutic applications of mouse Atlastin-2 research include:

  • Cancer therapies: High ATL2-2 expression has been associated with worse prognosis in breast cancer, with tumors showing upregulation of key cancer pathways like MYC targets and E2F targets . This suggests that targeting ATL2 function could potentially modulate cancer progression, particularly in estrogen-receptor-positive luminal tumors where high ATL2-2 levels predict shorter survival .

  • Neurological disorders: Given that neurons express specific ATL2 splice variants with enhanced fusion activity , targeting these variants might be relevant for neurological conditions involving ER dysfunction. The specialized regulation of neuronal ATL2 suggests a critical role in maintaining proper neuronal ER morphology.

  • Metabolic disorders: ATL2's role in lipid droplet formation in murine breast tissue suggests potential applications in metabolic conditions involving dysregulated lipid storage and metabolism. Modulating ATL2 activity might help normalize lipid handling in certain metabolic disorders.

  • ER stress-related diseases: As a key regulator of ER membrane fusion, ATL2 could be targeted in conditions characterized by ER stress and unfolded protein response activation, which are implicated in various diseases including diabetes, neurodegenerative disorders, and inflammatory conditions.

What new techniques or approaches might advance our understanding of mouse Atlastin-2 regulation and function?

Emerging techniques that could significantly advance our understanding of mouse Atlastin-2 include:

  • Cryo-electron microscopy: Obtaining high-resolution structures of full-length mouse Atlastin-2 in different conformational states would provide crucial insights into the autoinhibition mechanism and the structural changes during the fusion process.

  • Single-molecule FRET: This technique could reveal the dynamic conformational changes of ATL2 during GTP binding, hydrolysis, and membrane fusion, offering real-time visualization of the fusion mechanism.

  • Optogenetic control of Atlastin-2 activity: Developing light-responsive ATL2 variants would allow precise temporal control of fusion activity, enabling studies of acute effects on ER morphology and function.

  • Advanced live-cell imaging: Super-resolution microscopy combined with genetically encoded sensors for ER structure and function would provide unprecedented views of how ATL2 dynamically shapes the ER network.

  • Tissue-specific and inducible genetic models: More sophisticated mouse models with conditional and cell-type-specific expression of ATL2 variants would help dissect its roles in different tissues and developmental stages.

  • Proteomics approaches: Proximity labeling techniques (BioID, APEX) could identify novel interaction partners of different ATL2 splice variants in various cellular contexts, revealing potential regulatory mechanisms.

What are the critical unsolved questions about mouse Atlastin-2 that merit further investigation?

Several critical questions about mouse Atlastin-2 remain unanswered and merit focused investigation:

  • Splice variant function: How do different mouse Atlastin-2 splice variants differ in their regulation, activity, and tissue-specific roles? Particularly, what are the specific functions of neuronal variants with enhanced fusion activity ?

  • Regulation beyond autoinhibition: What additional mechanisms regulate Atlastin-2 activity in vivo? Are there post-translational modifications, protein-protein interactions, or lipid-dependent regulations that modulate its function?

  • Role in disease pathogenesis: How exactly does ATL2 dysregulation contribute to cancer progression, particularly in breast cancer where high ATL2-2 expression associates with worse prognosis ? What are the molecular mechanisms linking ATL2 to MYC targets, E2F targets, and G2M checkpoint pathways ?

  • Interaction with other ER-shaping proteins: How does Atlastin-2 functionally interact with other proteins involved in ER morphology, such as reticulons, CLIMP63, and other fusion/fission mediators?

  • Lipid metabolism connection: What is the detailed mechanism by which ATL2 contributes to lipid droplet formation in murine breast tissue , and does this function extend to other tissues?

  • Therapeutic targeting potential: Can ATL2 be specifically targeted for therapeutic intervention in cancer or other diseases, and what approaches would provide the necessary specificity to avoid disrupting essential ER functions?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.