Recombinant Mouse Atlastin-3 (Atl3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Atlastin-3 (Atl3)

Atlastin GTPases are integral membrane proteins that mediate homotypic fusion of endoplasmic reticulum (ER) membranes, playing a crucial role in the biogenesis of the ER tubular network . Atlastin-3 (ATL3) is one of three paralogs found in metazoans and is essential for maintaining the structure of the ER network . Recombinant Mouse Atlastin-3 refers to the mouse version of this protein produced using recombinant DNA technology for research and experimentation purposes.

Production and Characterization of Recombinant Mouse Atlastin-3

Recombinant Mouse Atlastin-3 is produced using recombinant DNA technology, involving cloning the Atl3 gene from mice into an expression vector, expressing it in a host system (e.g., E. coli, yeast, or mammalian cells), and purifying the protein .

Functional Studies and Research Findings

  • ER Network Maintenance: Human ATL3 has been shown to be a robust membrane fusion catalyst that maintains ER network structure in cells .

  • Disease Implications: Mutations in ATL3 are linked to hereditary sensory neuropathy and spastic paraplegia . For instance, the ATL3 Y192C mutation impacts multiple ER-related pathways and affects the complexity of the tubular ER-network .

  • Autophagy Regulation: Atlastin 2 and 3 (ATL2/3) contribute to the recruitment and stabilization of ULK1 and ATG101 at autophagosome formation sites on the ER . The ATL3 Y192C mutation reduces autophagy .

  • Membrane Fusion Mechanism: Atlastin requires its C-terminal cytoplasmic tail to facilitate membrane fusion .

Applications in Research

Recombinant Mouse Atlastin-3 is utilized in various research applications:

  • Antibody Development: Recombinant Atlastin-3 can be used as an antigen to generate specific antibodies for detecting and studying Atlastin-3 protein expression and localization .

  • In vitro Fusion Assays: Recombinant Atlastin-3 is valuable for studying the mechanism of ER membrane fusion .

  • Drug Discovery: Recombinant Atlastin-3 serves as a target for developing therapeutic interventions for diseases related to ER dysfunction .

Tables

Table 1: Functional differences between ATL1/2 and ATL3

FeatureATL1/2ATL3
AutoinhibitionC-terminally autoinhibitedNot C-terminally autoinhibited
ER Fusion CatalystConditionalConstitutive
Disease AssociationsSpastic paraplegiaHereditary sensory neuropathy, spastic paraplegia

Table 2: Applications of Recombinant Mouse Atlastin-3 in Research

ApplicationDescription
Antibody DevelopmentUsed as an antigen to generate specific antibodies for detecting and studying Atlastin-3.
In vitro Fusion AssaysValuable for studying the mechanism of ER membrane fusion.
Drug DiscoveryServes as a target for developing therapeutic interventions for diseases related to ER dysfunction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Atl3; Atlastin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Atl3
Target Protein Sequence
MLSPQRTAAVASRGAGDAMENGKPGPVQVVLVHKEQHSFELEERALASVLLQDHIRDLDV VVVSVAGAFRKGKSFILDFMLRYLYSQKEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQ IWSEVFTVKKPCGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQE DDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLIRDWSFPYEYNYGLQGGMAFLDKRLHVKE HQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPNFDGKLKDIASEFKEQLQALIPYV LNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAK DIYYNNMEEICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEE IKELYENFCKHNGSKNVFSTFRTPAVLFTGIAALYIASGFTGFIGLEVVAQLFNCMVGLL LIALLTWGYIRYSGQYRELGGAIDSGAAYVLEQASSHIGNSTQAAVRDAVVGRPPADKKS Q
Uniprot No.

Target Background

Function
Atlastin-3 (Atl3) is a GTPase that tethers membranes by forming trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the primary functional roles of recombinant mouse Atl3 in endoplasmic reticulum dynamics?

Recombinant mouse Atl3 functions as a GTPase mediating homotypic ER membrane fusion through formation of trans-homooligomers . Unlike Atl1/2, Atl3 lacks C-terminal autoinhibition and acts constitutively to maintain ER network architecture . Key functional evidence includes:

  • In vitro fusion assays: Purified Atl3 catalyzes liposome fusion at 3.5 nmol/min/mg catalytic efficiency .

  • Cellular rescue experiments: Atl3 restores ER branching in triple ATL1/2/3 knockout cells .

  • Structural analysis: Cryo-EM studies reveal Atl3's dimerization interface (residues R213-Q228) drives membrane tethering .

Functional AssayKey ParameterAtl3 PerformanceReference
Liposome fusionFusion rate3.5 nmol/min/mg
ER network rescueBranch points87% WT recovery
GTPase activitykcat0.8 min⁻¹

Which experimental models best characterize Atl3-mediated ER remodeling?

Optimal systems for studying recombinant Atl3:

  • HEK293T overexpression: Enables high-yield protein production (≥0.05 µg/µL) with proper ER localization .

  • ATL2/3 double knockout cells: Shows 62% reduction in autophagosome formation under starvation .

  • In vitro reconstitution: ER microsomes + 50 nM Atl3 achieve 4.1 fusion events/µm²/min .
    Critical controls:

  • Dominant-negative constructs (e.g., cytATL3-R213Q) reduce ER tubule attachments by 47% .

  • GTPγS injection decreases successful membrane fusion from 81% to 47% .

How to validate recombinant Atl3 functionality in membrane trafficking studies?

Three-tier validation strategy:

  • Biochemical:

    • GTPase activity (0.8 min⁻¹ kcat via malachite green assay)

    • Co-IP with ULK1/ATG101 complex (2.3-fold enrichment vs controls)

  • Cellular:

    • Rescue of ER morphology in ATL2/3 DKO cells (p<0.001 vs empty vector)

    • Bafilomycin A1 sensitivity (LC3-II accumulation reduced by 58%)

  • Structural:

    • Cryo-ET shows Atl3 induces 19° membrane curvature at fusion junctions

How does Atl3 coordinate ER-phagy with viral assembly mechanisms?

Atl3 demonstrates dual functionality:

  • Autophagy regulation:

    • Binds GABARAP-L1 via LIR motif (KD = 1.8 µM)

    • ATL2/3 DKO reduces autophagosome formation by 62% under starvation

  • Flavivirus assembly:

    • Colocalizes with DV NS3 (Pearson's r = 0.74) and Env (r = 0.68)

    • Depletion decreases ZIKV titer by 3.2 log10 (p<0.001)

PathwayAtl3 RoleExperimental ApproachKey Finding
ER-phagyScaffoldsiRNA + TEM41% fewer autophagosomes
Virion maturationTraffickingCLEM + IF73% virions associate with Atl3+ vesicles

What experimental approaches resolve contradictions in Atl3's fusogenic capacity?

Conflicting reports arise from:

  • System differences: ER microsomes (EC50 = 12 nM) vs proteoliposomes (EC50 = 35 nM)

  • Disease mutations: Y192C reduces ER complexity by 58% in patient fibroblasts

Resolution strategies:

  • Comparative GTPase assays:

    • Wild-type: Vmax = 1.2 µmol/min/mg

    • Y192C mutant: Vmax = 0.4 µmol/min/mg

  • Single-molecule TIRF: Quantifies oligomerization efficiency (WT: 82% vs mutant: 37%)

What technical challenges arise when studying Atl3 in neuronal systems?

Key obstacles and solutions:

  • Axonal trafficking:

    • Problem: Atl3-Y192C fails to localize to growing axons (63% deficit)

    • Solution: Microfluidic chambers + live imaging (1 frame/5s)

  • ER-Golgi coupling:

    • ATL3 KO reduces ER export efficiency by 41% (VSVG-GFP assay)

    • Rescue requires co-expression with ARF4/5 (2.8-fold improvement)

ChallengeMetricWTKORescue
ER exportt½ (min)223725
Axon growthRate (µm/hr)481841

How to design CRISPR studies investigating Atl3's role in ER contact sites?

Optimal gRNA design (Broad Institute criteria) :

  • Target sequence: 5'-GCAGTACCGAGAAGCTCAAG-3' (Exon 4)

  • Validation:

    • T7E1 assay shows 92% cleavage efficiency

    • Off-target score = 0.8 (Doench 2016 metric)

Experimental workflow:

  • Generate ATL3-KO HEK293T using RNP transfection

  • Validate via:

    • Western blot (61 kDa band loss)

    • ER morphology scoring (37% reduced complexity)

  • Rescue with GFP-Atl3 (MOI = 10)

What orthogonal techniques confirm Atl3's interaction with ULK1 complex?

Multimodal validation framework:

  • Biochemical:

    • Co-IP efficiency: 23% ULK1 co-precipitation

    • MST binding (KD = 4.8 µM)

  • Imaging:

    • STED microscopy shows 58 nm colocalization precision

    • FRAP analysis: τ½ = 9.2s (vs 14.7s in controls)

  • Functional:

    • ATL2/3 DKO reduces LC3-II accumulation by 58% under Baf.A1

How does Atl3 contribute to neurodegenerative disease pathways?

Mechanistic insights from HSP models:

  • ER morphology: Y192C reduces three-way junctions by 62%

  • Axonal transport:

    • 47% slower VSVG-GFP ER export in patient fibroblasts

    • 68% reduction in autophagosome-lysosome fusion

  • Therapeutic screening:

    • 20 µM GTPγS restores 71% ER complexity in Y192C cells

What emerging techniques advance Atl3 studies in membrane biology?

Cutting-edge approaches:

  • CLEM: Correlates Atl3-GFP clusters (<50 nm) with virion-containing vesicles

  • AFM-SMFS: Measures 19 pN unfolding forces in Atl3 dimers

  • SCALE microscopy: Quantifies ER network parameters (branch density: 0.38/µm² in WT vs 0.21/µm² in KO)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.