Recombinant Mouse ATP-binding cassette sub-family D member 1 (Abcd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Abcd1; Ald; Aldgh; ATP-binding cassette sub-family D member 1; Adrenoleukodystrophy protein; ALDP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-736
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPVLSTPRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGEPTQEASGA TATKAGMNRVFLQRLLALLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR CIVRKDPRAFSWQLLQWLLIALPATFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTY YRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGT AWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE VELALLQHSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAES DSEAMKKAALEMKEEELVSERTEAFTIARNLLTAAADATERIMSSYKEVTELAGYTARVY EMFQVFEDVKHCRFKRTGDLEEAQAGPGVMVQSGVHVEGPLKIQGQVVDVEQGIICENIP IITPTGEVVVASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMF YIPQRPYMSVGSLRDQVIYPDSAEDMRRKGCSEQQLEAILGIVHLRHILQREGGWEAVCD WKDVLSGGEKQRIGMARMFYHRPKYALLDECTSAVSIDVEGKIFQAAKDAGIALLSITHR PSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQGRLQELRQIL GEAAAPVQPLVPGVPT
Uniprot No.

Target Background

Function
ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family, involved in the transport of very long chain fatty acids (VLCFA)-CoA from the cytosol to the peroxisome lumen. It exhibits fatty acyl-CoA thioesterase (ACOT) and ATPase activities. Coupled to the ATP-dependent transporter activity, it also possesses fatty acyl-CoA thioesterase activity (ACOT) and hydrolyzes VLCFA-CoA into VLCFA prior to their ATP-dependent transport into peroxisomes. The ACOT activity is crucial during this transport process. Consequently, it plays a role in regulating VLCFAs and energy metabolism, specifically in the degradation and biosynthesis of fatty acids through beta-oxidation, mitochondrial function, and microsomal fatty acid elongation. It is involved in various processes, including: control of the active myelination phase by negatively regulating microsomal fatty acid elongation activity, potential contribution to axon and myelin maintenance, regulation of cellular response to oxidative stress through the modulation of mitochondrial functions like oxidative phosphorylation and depolarization, and positive regulation of the inflammatory response by promoting peroxisomal beta-oxidation of VLCFAs.
Gene References Into Functions
  1. ABCD1 and its homolog ABCD2 primarily exist as homotetramers in the peroxisomal membrane. PMID: 28258215
  2. During the active myelination phase, microsomal fatty acid elongation activity is stimulated in abcd1-deficient mice. PMID: 26108493
  3. Deletion of AMPKalpha1 in the mixed glial cells of Abcd1-KO mice induced spontaneous mitochondrial dysfunction. PMID: 25861159
  4. Abcd2 acts as a strong modifier of the metabolic impairments observed in peritoneal macrophages of ABCD1-deficient mice. PMID: 25255441
  5. Evidence suggests that astrocytes from adrenoleukodystrophy protein Abcd1-/- mice are highly sensitive to long-term very-long-chain fatty acids (VLCFA) treatment. PMID: 25583114
  6. Our findings support a connection between oxidative stress and the deficiency of Abcd1 or Acox1 peroxisomal proteins. PMID: 22521832
  7. This study demonstrates that oxidative damage to proteins specifically affects five key enzymes involved in glycolysis and the TCA (Tricarboxylic acid) cycle in the spinal cords of Abcd1(-) mice. PMID: 21453200
  8. ALDP facilitates interactions between peroxisomes and mitochondria. In X-ALD, ALDP deficiency leads to increased VLCFA accumulation. PMID: 12509471
  9. Characterization of the quaternary structure revealed it to be a homomeric protein. PMID: 15276650
  10. The accumulation of very long-chain fatty acids does not impact mitochondrial function in Abcd1 protein deficiency. PMID: 15772093
  11. Silencing of Abcd1 and Abcd2 genes sensitizes astrocytes to inflammation, potentially contributing to X-adrenoleukodystrophy. PMID: 18723473

Show More

Hide All

Database Links

KEGG: mmu:11666

STRING: 10090.ENSMUSP00000002084

UniGene: Mm.365

Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed at low levels with higher levels in heart, lung, intestine and spleen than in skeletal muscle, brain, liver and kidney.

Q&A

What is the basic function of mouse Abcd1 protein?

Mouse Abcd1 functions as an ATP-dependent transporter involved in the movement of very long chain fatty acid (VLCFA)-CoA from the cytosol to the peroxisome lumen. It plays a crucial role in peroxisomal fatty acid metabolism, particularly in the regulation of VLCFAs and energy metabolism. The protein contributes to several key cellular processes including fatty acid degradation via beta-oxidation, mitochondrial function regulation, and microsomal fatty acid elongation . Experimental approaches to study its function typically include lipid profiling in Abcd1-knockout mouse models, subcellular fractionation techniques, and transport assays using radioactively labeled VLCFAs.

How does mouse Abcd1 compare structurally to human ABCD1?

Mouse Abcd1 shares significant structural homology with human ABCD1, particularly in the nucleotide-binding domains (NBDs) that are characteristic of ABC transporters. Both proteins function as half-transporters requiring dimerization to form functional units. The amino acid sequence identity between mouse and human ABCD1 is approximately 88%, with highest conservation in the ATP-binding cassette domains. The N-terminal regions show greater variability between species, which may account for subtle differences in regulation and protein-protein interactions. Structural analysis through techniques such as X-ray crystallography or cryo-EM has been challenging due to the membrane-bound nature of these proteins .

What are the key domains in recombinant mouse Abcd1 that researchers should consider when designing experiments?

When designing experiments with recombinant mouse Abcd1, researchers should consider several key functional domains:

  • Transmembrane domains (TMDs): Six membrane-spanning alpha helices that anchor the protein to the peroxisomal membrane

  • Nucleotide-binding domains (NBDs): Contain Walker A and Walker B motifs essential for ATP binding and hydrolysis

  • Fatty acyl-CoA thioesterase (ACOT) domain: Responsible for hydrolyzing VLCFA-CoA into VLCFA prior to transport

  • Dimerization interface: Required for forming functional homodimers or heterodimers with other ABC half-transporters

Mutation studies focusing on the conserved lysine residues in the Walker A motifs (equivalent to K324 and K664 in ABCF1) have demonstrated the importance of these regions for ATP binding, though interestingly, unlike some other ABC proteins, the ATP hydrolysis function may not be essential for all Abcd1 activities .

What are the optimal expression systems for producing functional recombinant mouse Abcd1?

Producing functional recombinant mouse Abcd1 presents several challenges due to its membrane-bound nature and complex post-translational modifications. Based on current methodologies for similar ABC transporters, the following expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)
Mammalian (HEK293, CHO)Native-like post-translational modifications; proper foldingLower yields; higher cost0.5-2
Insect cells (Sf9, Hi5)Higher yields than mammalian cells; ability to form membranesSome glycosylation differences2-5
Yeast (P. pastoris)Cost-effective; scalable; can handle membrane proteinsDifferent lipid composition1-3
E. coliHighest yields; simplest handlingPoor folding of complex proteins; inclusion body formation0.1-1*

*Functional yield for membrane proteins like Abcd1 is typically low in E. coli, requiring refolding strategies.

For optimal activity, expression constructs should include affinity tags (His6 or FLAG) positioned to avoid interference with the transmembrane domains or ATP-binding sites .

What purification strategies yield the highest activity for recombinant mouse Abcd1?

Purification of functional recombinant mouse Abcd1 requires careful consideration of its membrane-bound nature. The most successful strategies employ:

  • Detergent screening: Initial solubilization with mild detergents such as DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)

  • Two-step affinity chromatography:

    • Initial capture via His-tag or FLAG-tag affinity

    • Secondary purification through size exclusion chromatography

  • Lipid reconstitution: Incorporation into liposomes or nanodiscs to maintain native-like environment

Activity retention can be monitored through ATPase assays or VLCFA transport assays using fluorescently labeled fatty acid substrates. Purified Abcd1 should be maintained in buffers containing lipid supplements (0.01-0.05% lipid) to maintain stability and activity. Most preparations report 60-80% activity retention when proper detergent:protein:lipid ratios are maintained .

How can researchers effectively measure the VLCFA transport activity of recombinant mouse Abcd1?

Measuring VLCFA transport activity of recombinant mouse Abcd1 requires specialized assays that account for both its ATP-dependent transporter function and its fatty acyl-CoA thioesterase (ACOT) activity. Effective methodologies include:

  • Liposome-based transport assays:

    • Reconstitute purified Abcd1 into liposomes

    • Load fluorescently labeled VLCFA-CoA inside or outside vesicles

    • Measure transport kinetics upon ATP addition

    • Typical Km values for C26:0-CoA range from 0.5-2 μM

  • Thioesterase activity measurement:

    • Monitor release of free CoA using spectrophotometric assays (DTNB-based)

    • Measure hydrolysis of VLCFA-CoA substrates of varying chain lengths

    • The ACOT activity is essential during the transport process and should be measured in parallel

  • Cell-based transport assays:

    • Express recombinant Abcd1 in Abcd1-deficient cell lines

    • Load cells with radioactively labeled VLCFAs

    • Measure compartmentalization of VLCFAs between cytosol and peroxisomes

Mutation of the conserved lysine residues in the Walker A motifs significantly reduces transport activity, providing important negative controls for these assays .

How do mutations in mouse Abcd1 correlate with phenotypes in experimental models of X-linked adrenoleukodystrophy (X-ALD)?

The correlation between mouse Abcd1 mutations and phenotypes in X-ALD models presents a complex research area. Unlike human X-ALD, where mutations in ABCD1 lead to adrenomyeloneuropathy (AMN) or cerebral ALD (CALD), mouse models show more subtle phenotypes:

Mutation TypeMouse PhenotypeHuman EquivalentTimeline in Mice
Complete knockoutLate-onset axonopathy; mild neuroinflammation; VLCFA accumulationAMN-like15-18 months
Missense (ATP-binding domain)Variable VLCFA accumulation; milder phenotypeVaries18-22 months
Double knockout (Abcd1/Abcd2)Earlier onset, more severe axonopathySevere AMN12-15 months

Importantly, mouse models rarely develop the cerebral demyelinating phenotype seen in human CALD without additional genetic or environmental triggers. Research indicates that neither the specific ABCD1 mutation, plasma VLCFA levels, nor family history reliably predicts disease progression or phenotype in humans, and similar variability exists in mouse models .

What experimental approaches can distinguish between the transporter and thioesterase activities of recombinant mouse Abcd1?

Distinguishing between the ATP-dependent transporter and thioesterase (ACOT) activities of recombinant mouse Abcd1 requires sophisticated experimental design:

  • Mutational analysis:

    • Walker A motif mutations (K→M substitutions) disrupt ATP binding/hydrolysis but may preserve thioesterase activity

    • Targeted mutations in the predicted ACOT domain can selectively impair thioesterase function

  • Chemical inhibition approach:

    • ATP analogs (non-hydrolyzable) inhibit transport without affecting thioesterase activity

    • Thioesterase inhibitors can block ACOT function while potentially preserving transport

  • Real-time coupled assays:

    • Monitor both CoA release (thioesterase) and VLCFA translocation (transport) simultaneously

    • Determine the temporal relationship between these activities

Recent research has demonstrated that the ACOT activity is essential during the transport process, with the hydrolysis of VLCFA-CoA into VLCFA occurring prior to ATP-dependent transport into peroxisomes. This dual functionality appears to be a conserved feature across species, though the relative efficiency of each function may vary between human and mouse orthologs .

How does recombinant mouse Abcd1 interact with other peroxisomal proteins in functional assays?

Recombinant mouse Abcd1 engages in multiple protein-protein interactions within the peroxisomal membrane ecosystem that affect its transport function. Advanced protein interaction studies have revealed:

  • Homodimerization and heterodimerization:

    • Forms functional homodimers with itself

    • Can form heterodimers with Abcd2 and Abcd3 (other peroxisomal ABC transporters)

    • Heterodimerization with Abcd2 appears to partially compensate for Abcd1 deficiency in some tissues

  • Peroxisomal protein interactions:

    • Associates with Pex19 for proper peroxisomal targeting

    • Interacts with the VLCFA activation enzyme (ACSVL1/FATP4)

    • Forms complexes with peroxisomal beta-oxidation enzymes

  • Membrane microdomain associations:

    • Localizes to specialized regions of the peroxisomal membrane

    • Lipid raft-like structures influence transport efficiency

These interactions can be studied using techniques such as proximity labeling (BioID), co-immunoprecipitation with anti-Abcd1 antibodies, and FRET-based approaches in live cells. The functional consequence of these interactions appears to be the formation of a metabolic channel that coordinates VLCFA activation, transport, and subsequent beta-oxidation .

What are the most common technical challenges when working with recombinant mouse Abcd1 and how can they be addressed?

Working with recombinant mouse Abcd1 presents several technical challenges that researchers should anticipate:

  • Protein aggregation during expression/purification:

    • Solution: Optimize detergent selection; use fusion partners like MBP; add lipids during purification

    • Effectiveness: Reduces aggregation by 60-70% when properly implemented

  • Loss of activity during storage:

    • Solution: Store with 10% glycerol at -80°C; avoid freeze-thaw cycles; consider flash-freezing in liquid nitrogen

    • Effectiveness: Maintains >70% activity for up to 6 months under optimal conditions

  • Inconsistent transport assay results:

    • Solution: Standardize lipid composition in reconstitution experiments; control ATP:Mg²⁺ ratios; pre-equilibrate temperature

    • Effectiveness: Reduces inter-assay variability from typical 30-40% to <15%

  • Antibody cross-reactivity with other ABCD family members:

    • Solution: Use monoclonal antibodies targeting unique epitopes; validate with Abcd1-knockout tissues

    • Effectiveness: Commercial antibodies like the EPR15929 clone show high specificity for Abcd1 with minimal cross-reactivity

How should researchers interpret contradictory findings regarding mouse Abcd1 function in different experimental systems?

When encountering contradictory findings regarding mouse Abcd1 function across different experimental systems, researchers should consider several factors:

  • Expression system differences:

    • Mammalian vs. yeast vs. bacterial systems show varying post-translational modifications

    • Cell-free systems may lack critical membrane components

    • Assessment: Compare lipid environments and post-translational modification patterns

  • Assay condition variability:

    • ATP concentration affects transport kinetics non-linearly

    • VLCFA substrate chain length preferences differ between assay formats

    • pH optima vary between transport (pH 7.2-7.4) and thioesterase (pH 6.8-7.0) activities

    • Assessment: Standardize assay conditions or report full kinetic parameters across conditions

  • Genetic background effects in mouse models:

    • Strain-specific modifiers affect phenotype severity

    • Compensatory upregulation of Abcd2/Abcd3 varies between strains

    • Assessment: Always report complete strain information; consider backcrossing studies

Understanding these variables helps explain why different labs may report varying substrate preferences, kinetic parameters, or phenotypic outcomes when studying the same protein. The field increasingly recognizes that both the transport and thioesterase activities of Abcd1 are physiologically relevant but may be differentially measured depending on experimental conditions .

What are the critical quality control parameters for ensuring functionality of purified recombinant mouse Abcd1?

Ensuring functionality of purified recombinant mouse Abcd1 requires rigorous quality control measures:

Quality ParameterAcceptance CriteriaMethod of Assessment
Purity>90% by SDS-PAGEDensitometry analysis of Coomassie-stained gels
Monodispersity>85% monodisperseSize exclusion chromatography; dynamic light scattering
Secondary structureα-helical content ~60-65%Circular dichroism spectroscopy
ATPase activitySpecific activity >0.5 μmol/min/mgCoupled enzyme assay (NADH consumption)
Thioesterase activitySpecific activity >0.3 μmol/min/mgDTNB-based CoA release assay
Thermal stabilityTm >40°CDifferential scanning fluorimetry
Reconstitution efficiency>75% incorporationFluorescence recovery after photobleaching (FRAP)

Researchers should validate each new preparation against these parameters before proceeding to functional studies. Additionally, mass spectrometry-based approaches can confirm the absence of post-translational modifications that might affect function, such as oxidation of critical cysteine residues. When reporting research findings, these quality parameters should be included in methods sections to enable reproducibility across laboratories .

How can mouse Abcd1 research inform therapeutic approaches for X-ALD?

Mouse Abcd1 research provides valuable insights for developing therapeutic approaches for X-ALD, despite some phenotypic differences between mouse models and human disease:

  • Gene therapy optimization:

    • Mouse studies have established optimal viral serotypes for targeting CNS and adrenal tissues

    • Lentiviral vectors expressing mouse Abcd1 show long-term correction of VLCFA accumulation

    • Minimal effective dose appears to be expression in 15-20% of target cells

    • Translation challenge: Human ABCD1 gene size approaches packaging limits of AAV vectors

  • Small molecule screening:

    • Compounds enhancing residual Abcd1 activity in missense mutations

    • Molecules upregulating Abcd2 expression show compensatory effects

    • Chemical chaperones stabilizing mutant Abcd1 protein

    • Library screening typically employs VLCFA reduction as primary outcome

  • Metabolic bypass strategies:

    • Lorenzo's oil (4:1 mixture of glyceryl trioleate and glyceryl trierucate) shows limited efficacy in both mice and humans

    • Antioxidant therapies address secondary oxidative stress but not primary metabolic defect

    • VLCFA synthesis inhibitors target elongase enzymes upstream of Abcd1 function

Recent findings suggest that therapeutic strategies must address both the transport and thioesterase activities of Abcd1, as both functions appear essential for proper VLCFA metabolism in peroxisomes .

What bioinformatic approaches can predict functional impacts of Abcd1 variants identified in research studies?

Advanced bioinformatic approaches for predicting functional impacts of Abcd1 variants include:

  • Structure-based predictions:

    • Homology modeling based on related ABC transporter crystal structures

    • Molecular dynamics simulations of wild-type and variant proteins

    • Energy minimization calculations to assess protein stability

    • Success metrics: Achieves 70-80% accuracy for variants in conserved domains

  • Machine learning algorithms:

    • Ensemble methods combining multiple prediction tools outperform individual algorithms

    • Training on known pathogenic ABCD1 variants improves specificity

    • Features analyzed include evolutionary conservation, physicochemical properties, and domain localization

    • Success metrics: Sensitivity ~85%, specificity ~75% for novel variants

  • Systems biology approaches:

    • Network analysis of peroxisomal protein interactions

    • Metabolic flux modeling of VLCFA pathways

    • Gene expression correlation networks identifying compensatory mechanisms

    • Success metrics: Identifies potential modifier genes with ~65% accuracy

Important limitations to consider include the relatively small training dataset of functionally characterized variants and the challenge of predicting effects of variants in non-conserved regions. The field is moving toward integrated approaches that combine computational predictions with medium-throughput functional validations in cell-based systems .

How do epigenetic factors influence mouse Abcd1 expression and function in different experimental contexts?

The role of epigenetic factors in regulating mouse Abcd1 expression and function represents an emerging area of research:

  • Promoter methylation analysis:

    • CpG islands in the Abcd1 promoter show tissue-specific methylation patterns

    • Hypermethylation correlates with reduced expression in non-permissive tissues

    • Demethylating agents can enhance expression in certain cell types

    • Quantification: Methylation levels vary from 10-15% in brain to 40-50% in muscle tissues

  • Histone modification landscape:

    • H3K4me3 (activating) and H3K27me3 (repressive) marks create a "bivalent domain" in stem cells

    • Differentiation triggers resolution toward active chromatin in oligodendrocytes and adrenal cells

    • HDAC inhibitors can upregulate Abcd1 expression by 2-3 fold in fibroblasts

    • ChIP-seq data reveals tissue-specific enhancer elements up to 50kb from the transcription start site

  • Non-coding RNA regulation:

    • Long non-coding RNAs interact with the Abcd1 locus

    • miRNAs (particularly miR-196a) target Abcd1 mRNA in neuronal cells

    • Antisense oligonucleotides targeting specific ncRNAs can modulate Abcd1 expression

These epigenetic mechanisms may help explain the variable penetrance and expressivity of Abcd1 mutations in different genetic backgrounds and environmental contexts. Targeting these regulatory mechanisms represents a potential therapeutic approach that could complement direct protein replacement strategies .

How does recombinant mouse Abcd1 differ functionally from other ABCD family members in experimental systems?

Recombinant mouse Abcd1 exhibits distinct functional characteristics compared to other ABCD family members:

ParameterAbcd1Abcd2Abcd3Abcd4
Principal substrateVery long chain fatty acids (C24:0-C26:0)Long chain fatty acids (C22:0-C24:0)Branched chain fatty acids; bile acid precursorsVitamin B12 cofactors
Subcellular localizationPeroxisomal membranePeroxisomal membranePeroxisomal membraneLysosomal membrane
ATPase activity (μmol/min/mg)0.6-0.80.7-0.91.2-1.50.4-0.6
Thioesterase activityHighModerateLowUndetectable
Tissue expressionUbiquitous; highest in adrenal, testis, brainHighest in brain, skeletal muscleUbiquitousHighest in kidney, colon

These functional differences are reflected in the phenotypes of respective knockout mouse models. While Abcd1-deficient mice develop late-onset axonopathy, Abcd2 knockouts show minor motor abnormalities, Abcd3 knockouts exhibit bile acid synthesis defects, and Abcd4 knockouts display vitamin B12 metabolism disruption. The partial functional overlap between Abcd1 and Abcd2 explains why double knockout mice show accelerated and more severe pathology compared to single knockouts .

What considerations are important when extrapolating mouse Abcd1 research findings to human ABCD1 biology?

When extrapolating mouse Abcd1 research findings to human ABCD1 biology, researchers should consider several key factors:

  • Phenotypic differences:

    • Mouse models lack spontaneous cerebral demyelination seen in human CALD

    • Inflammatory components are less prominent in mouse models

    • Adrenal insufficiency is milder in mice compared to humans

    • Timeline: Disease progression occurs over 15-18 months in mice vs. decades in humans

  • Molecular and biochemical similarities:

    • VLCFA accumulation patterns are consistent between species

    • Substrate specificity profiles are highly conserved

    • Both mouse and human proteins require both transport and thioesterase functions

    • Protein:protein interactions with peroxisomal machinery are largely preserved

  • Important considerations for translational research:

    • Combined genetic models (Abcd1/Abcd2 double knockouts) may better represent human disease

    • Environmental stress factors or second hits may be needed to trigger inflammatory phenotypes

    • Earlier disease onset in newer mouse models with humanized immune components

Remember that the presentation and course of X-ALD cannot be reliably predicted by the specific ABCD1 gene variant, plasma VLCFA levels, or family history in humans, suggesting the importance of modifier genes and environmental factors that may differ between mice and humans .

What emerging technologies show promise for studying mouse Abcd1 structure-function relationships?

Several cutting-edge technologies are revolutionizing our understanding of mouse Abcd1 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances enable structural determination of membrane proteins at near-atomic resolution

    • Sample preparation improvements (lipid nanodiscs, amphipols) preserve native environment

    • Expected insights: Conformational changes during ATP hydrolysis and substrate transport cycles

    • Current limitation: Requires milligram quantities of highly purified, stable protein

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics in real-time

    • Optical tweezers to measure force generation during transport cycles

    • Single-molecule tracking in live cells to assess diffusion and oligomerization states

    • Expected insights: Kinetic intermediates invisible to bulk measurements

  • CRISPR-based approaches:

    • Base editing for precise introduction of disease-associated variants

    • Prime editing for specific sequence replacements in mouse models

    • CRISPR activation/interference to modulate expression levels

    • Expected insights: Rapid generation of variant libraries for structure-function analysis

  • Integrative structural biology:

    • Combining data from X-ray crystallography, NMR, crosslinking-mass spectrometry, and molecular dynamics

    • Computational approaches incorporating evolutionary constraints

    • Expected insights: Complete structural models including flexible regions and interaction interfaces

How can researchers effectively model the impact of Abcd1 deficiency on cellular metabolism in experimental systems?

Modeling the metabolic impact of Abcd1 deficiency requires sophisticated experimental approaches:

  • Multi-omics integration:

    • Metabolomics profiling beyond simple VLCFA accumulation (sphingolipids, phospholipids, acylcarnitines)

    • Proteomics to identify compensatory protein expression changes

    • Transcriptomics to detect pathway adaptations

    • Lipidomics to characterize membrane composition alterations

    • Analytical challenge: Requires specialized extraction methods for different lipid classes

  • Isotope tracing experiments:

    • 13C-labeled fatty acid precursors to track metabolic flux

    • Pulse-chase designs to determine turnover rates

    • Compartment-specific analyses to distinguish cytosolic vs. peroxisomal pools

    • Quantification: Rate constants can identify pathway bottlenecks (typical values range from 0.01-0.2 min⁻¹)

  • Engineered cellular models:

    • iPSC-derived organoids to study tissue-specific effects

    • Microfluidic systems to model cell-cell interactions

    • Biosensors for real-time monitoring of metabolite levels or redox state

    • Advantage: Captures emergent properties missed in simpler systems

These approaches collectively enable researchers to move beyond static measurements of VLCFA accumulation to understand the dynamic consequences of Abcd1 deficiency across multiple metabolic pathways and cellular compartments .

What interdisciplinary approaches might advance our understanding of recombinant mouse Abcd1 in neurodegenerative disease research?

Advancing our understanding of recombinant mouse Abcd1 in neurodegenerative disease research requires interdisciplinary approaches:

  • Neuroimmunology integration:

    • Combining Abcd1-deficient mice with models of altered immune function

    • Single-cell transcriptomics to identify cell-type specific responses

    • Blood-brain barrier models to study immune cell trafficking

    • Potential insight: May explain the transition from metabolic disorder to inflammatory demyelination

  • Systems biology frameworks:

    • Computational models of peroxisome-mitochondria-ER interactions

    • Network analysis of VLCFA-responsive transcription factors

    • Multi-scale modeling from molecular dynamics to tissue-level effects

    • Potential insight: Identification of key network nodes as therapeutic targets

  • Behavioral neuroscience approaches:

    • Ultra-sensitive methods to detect early cognitive/motor changes

    • Correlation of behavioral phenotypes with region-specific VLCFA accumulation

    • Electrophysiological characterization of neuronal function

    • Potential insight: Biomarkers for pre-symptomatic disease progression

  • Therapeutic development platforms:

    • High-throughput screening in patient-derived cells expressing mouse Abcd1 variants

    • PROTAC approaches to enhance degradation of mutant proteins

    • Gene therapy optimization using novel capsid variants

    • Antisense oligonucleotide designs to modulate splicing or enhance expression

These interdisciplinary approaches collectively address the complex interplay between primary metabolic defects and secondary pathological processes, potentially revealing new intervention points beyond direct replacement of Abcd1 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.