Recombinant Mouse ATP-binding cassette sub-family D member 2 (Abcd2)

Shipped with Ice Packs
In Stock

Description

Functional Partners and Domains

Abcd2 belongs to the ATP-binding cassette (ABC) transporter family, functioning as a half-transporter. It dimerizes with other ABC transporters (e.g., Abcd1) to form functional heterodimers. While its exact substrate specificity overlaps with Abcd1, it has distinct roles in metabolizing long-chain saturated fatty acids (LCFAs) and ω9-monounsaturated fatty acids (MUFAs) .

Experimental Uses

Recombinant Abcd2 serves as a critical reagent in:

ApplicationPurposeExperimental Context
Positive ControlValidates antibody specificity in Western blot (WB) or immunoprecipitation (IP)
ImmunogenGenerates anti-Abcd2 antibodies for detection in tissues or cells
SDS-PAGE and WB AnalysisConfirms protein expression/purity in recombinant systems

Key Research Insights

Abcd2’s role in fatty acid metabolism is well-documented:

  1. VLCFA β-oxidation: Compensates for Abcd1 deficiency in peroxisomal very long-chain fatty acid (VLCFA) degradation in mice, though with reduced efficiency .

  2. ω9-MUFA Metabolism: Knockout mice show elevated C20:1ω9 and C22:1ω9 in adrenal glands, sciatic nerves, and spinal cords .

  3. DHA Synthesis: Required for docosahexaenoic acid (DHA) production, a neuroprotective ω3 fatty acid .

Fatty Acid Profiles in Mouse Models

Abcd2-deficient mice exhibit tissue-specific lipid abnormalities:

TissueAltered Fatty AcidsFold Change vs. Wild-TypeSource
Adrenal GlandC20:0, C20:1ω9, C22:1ω92–3x (saturated), 4–5x (MUFAs)
Sciatic NerveC20:1ω9, C22:1ω93–4x (MUFAs)
Spinal CordC22:1ω92x (MUFAs)

VLCFA Accumulation in Double Knockouts

In Abcd1/Abcd2 double-deficient mice:

  • VLCFA (C26:0): 6x accumulation in macrophages vs. Abcd1-deficient mice .

  • β-oxidation Activity: 29% of wild-type levels (vs. 62% in Abcd1-deficient mice) .

Therapeutic Implications

  • X-Adrenoleukodystrophy (X-ALD): Overexpression of Abcd2 rescues VLCFA accumulation in Abcd1-deficient mice, suggesting its potential as a therapeutic target .

  • Neurodegenerative Diseases: Lower DHA levels correlate with Alzheimer’s risk; Abcd2’s role in DHA synthesis highlights its relevance to neuroprotection .

Thermal Stability

  • 37°C Incubation: <5% degradation over 48 hours (accelerated stability test) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Abcd2; Aldr; ATP-binding cassette sub-family D member 2; Adrenoleukodystrophy-related protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Abcd2
Target Protein Sequence
MIHMLNAAAYRVKWTRSGAAKRAACLVAAAYALKTLYPIIGKRLKQPGHRKAKAEAYSPA ENREILHCTEIICKKPAPGLNAAFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFL SIYVAGLDGKIVKSIVEKKPRTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLV DHAYETYFANQTYYKVINMDGRLANPDQSLTEDIMMFSQSVAHLYSNLTKPILDVILTSY TLIRTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGSLVAEEAHRKGYLRYVHSRII ANVEEIAFYRGHKVEMKQLQKCYKALAYQMNLILSKRLWYIMIEQFLMKYVWSSCGLIMV AIPIITATGFADGDLEDGPKQAMVSDRTEAFTTARNLLASGADAIERIMSSYKEITELAG YTARVYNMFWVFDEVKRGIYKRTVTQEPENHSKRGGNLELPLSDTLAIKGTVIDVDHGII CENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPP PQHMFYIPQRPYMSLGSLRDQVIYPDSADDMREKGYTDQDLERILHSVHLYHIVQREGGW DAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAIGAGISLL SITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNE LCKILGEDSVLKTIQTPEKTS
Uniprot No.

Target Background

Function
Recombinant Mouse ATP-binding cassette sub-family D member 2 (ABCD2) is an ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family. It facilitates the translocation of very long-chain fatty acyl-CoAs (VLCFA-CoAs) from the cytosol into the peroxisomal lumen. ABCD2 exhibits both fatty acyl-CoA thioesterase (ACOT) and ATPase activities. The prevailing model suggests that VLCFA-CoAs are hydrolyzed to free VLCFAs via the ACOT activity of ABCD2, followed by ATP-dependent transport into peroxisomes. ABCD2 shows overlapping substrate specificity with ABCD1 for saturated and monounsaturated fatty acids (FAs and MUFAs), but displays a distinct preference for shorter VLCFAs (e.g., C22:0) and polyunsaturated fatty acids (PUFAs) like C22:6-CoA and C24:6-CoA (in vitro). Therefore, ABCD2 likely plays a crucial role in regulating VLCFA levels and energy metabolism, specifically in fatty acid β-oxidation and biosynthesis.
Gene References Into Functions
  1. ABCD1 and its homolog ABCD2 primarily exist as homotetramers in the peroxisomal membrane. PMID: 28258215
  2. Abcd2 significantly modifies metabolic impairments in peritoneal macrophages of ABCD1-deficient mice. PMID: 25255441
  3. Studies have analyzed D2 localization and the proteome of D2-containing organelles in adipose tissue. PMID: 25446110
  4. ABCD2 deficiency alters the expression of gene clusters involved in lipid metabolism, including PPARα signaling. PMID: 25123288
  5. ABCD2 plays an essential role in protecting against dietary erucic acid. PMID: 22493092
  6. ABCD2, a sterol regulatory element binding protein target gene, is highly abundant in fat and counteracts the accumulation of dietary lipids, typically absent from the adipose tissue triglyceride storage pool. PMID: 19556607
  7. Evidence suggests that the adrenoleukodystrophy-related gene does not act as a modifier of X-adrenoleukodystrophy. PMID: 14713219
  8. Abcd1 and Abcd2 gene silencing sensitizes astrocytes to inflammation and may be involved in X-adrenoleukodystrophy. PMID: 18723473
  9. ABCD2 participates in the degradation of long-chain saturated and ω9-monounsaturated fatty acids and in the synthesis of docosahexaenoic acid. PMID: 18854420
Database Links
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in brain and adrenals, and weakly expressed in liver.

Q&A

What is Abcd2 and what is its primary function?

Abcd2 (ATP-binding cassette sub-family D member 2) is a peroxisomal membrane transporter protein involved in the transport of very long-chain fatty acids (VLCFAs) into peroxisomes for β-oxidation. It is the closest homologue of Abcd1, with overlapping but distinct substrate specificities . Abcd2 plays a crucial role in lipid metabolism, particularly in the processing of VLCFAs in various tissues. Research indicates that Abcd2 can functionally compensate for Abcd1 deficiency when overexpressed, suggesting therapeutic potential for disorders like X-linked adrenoleukodystrophy (X-ALD) . Unlike many peroxisomal proteins, Abcd2 displays unique fractionation behavior in adipose tissue, suggesting it may identify a specialized subclass of peroxisomes .

How does Abcd2 compare to other ABC transporters in the sub-family D?

Abcd2 shares significant structural and functional homology with other members of the ABC sub-family D, particularly Abcd1. In wild-type conditions, Abcd2 mRNA is approximately half as abundant as Abcd1 mRNA, indicating differential expression patterns . While Abcd1 and Abcd2 have overlapping substrate specificities for VLCFAs, they likely transport different yet related lipid species. Studies in heterologous yeast systems have confirmed these distinct but partially redundant substrate profiles . Unlike Abcd1, where deficiency leads to consistent VLCFA accumulation, Abcd2 deficiency alone does not generally result in widespread VLCFA accumulation except in specific tissues like dorsal root ganglia . This indicates tissue-specific roles for Abcd2 that cannot be fully compensated by other transporters.

What are the key tissues where Abcd2 is predominantly expressed?

Abcd2 shows tissue-specific expression patterns that differ from other peroxisomal transporters. While comprehensive expression data is still emerging, research indicates Abcd2 is expressed in macrophages at levels comparable to Abcd1 in Abcd1-deficient conditions, suggesting possible compensatory upregulation . Notably, Abcd2 has been identified in adipose tissue where it displays unique subcellular localization compared to other peroxisomal proteins . Other tissues with significant Abcd2 expression include neural tissues, particularly dorsal root ganglia where Abcd2 deficiency leads to VLCFA accumulation even as a single gene defect . This tissue-specific expression pattern may explain why loss of Abcd2 produces selective metabolic impairments rather than systemic dysfunction.

What mouse models are available for studying Abcd2 function?

Several genetically modified mouse models have been developed to study Abcd2 function:

  • Abcd2 knockout mice: These mice carry a null mutation in the Abcd2 gene, created by replacing part of the gene with a neomycin resistance gene (neo) . Genotyping can be performed using PCR with specific primers: forward 5′-TTCTAAGTGCCGCTGAGCATGC-3′ in combination with reverse 5′-CTGCTGCATTTAGCATGTGTATC-3′ for the wild-type allele (yielding a 466-bp PCR product) and reverse 5′-CCATCTTGTTCAATGGCCGATC-3′ for the knockout (neo) allele .

  • Abcd1/Abcd2 double-knockout mice: These models allow researchers to study the combined loss of both transporters and reveal the compensatory role of Abcd2 . The double knockout demonstrates much more severe VLCFA accumulation than single Abcd1 deficiency.

  • Tissue-specific Abcd2 transgenic models: Various research groups have developed models with Abcd2 overexpression to investigate its compensatory potential for Abcd1 deficiency.

These models provide valuable tools for investigating the physiological roles of Abcd2 in lipid metabolism and its potential as a therapeutic target.

What are reliable methods for isolating Abcd2-containing peroxisomes from mouse tissues?

Isolation of Abcd2-containing peroxisomes presents unique challenges compared to standard peroxisome isolation protocols, particularly from adipose tissue. A modified approach for adipose tissue includes:

  • Tissue preparation: Freshly dissected mouse adipose tissue should be homogenized in detergent-free buffer to prevent membrane disruption .

  • Sequential centrifugation: Following a modified differential centrifugation protocol:

    • Generate post-nuclear supernatant (PNS) by low-speed centrifugation

    • Obtain heavy mitochondrial pellet (HMt) and supernatant (HMS)

    • Collect light mitochondrial pellet (LMt) at 27,000g – this fraction contains Abcd2 in adipose tissue

    • Further fractionate light mitochondrial supernatant (LMS) and light membranes (LMbn)

  • Important observation: Unlike liver peroxisomes where multiple markers co-fractionate in the LMt, in adipose tissue, Abcd2 uniquely sediments in the LMt while other peroxisomal markers (catalase, PEX19, D3/PMP70) remain in suspension . This suggests Abcd2 identifies a distinct subclass of peroxisomes in adipose tissue.

  • Verification: Electron microscopy of the LMt fraction can confirm the presence of peroxisome-like structures with characteristic dense matrix and ~0.2 μm diameter .

This specialized protocol accounts for the unique behavior of Abcd2-containing organelles in adipose tissue compared to conventional peroxisome isolation methods.

What techniques are most effective for quantifying Abcd2 expression levels?

Several complementary techniques provide reliable quantification of Abcd2 expression:

  • Quantitative RT-PCR: For mRNA quantification, qRT-PCR offers high sensitivity and specificity. Studies have successfully used this method to show that Abcd2 mRNA is approximately half as abundant as Abcd1 mRNA in wild-type cells and similarly abundant in Abcd1-deficient macrophages .

  • Western blotting: For protein detection and semi-quantification, Western blotting using specific antibodies against Abcd2 is effective. This technique has been used to track Abcd2 distribution during subcellular fractionation .

  • Immunofluorescence microscopy: For spatial localization, immunofluorescence with Abcd2-specific antibodies can reveal its distribution pattern within cells and tissues.

  • Mass spectrometry: For comprehensive protein identification and quantification, proteomic approaches can identify Abcd2 and its associated proteins in purified peroxisomal fractions .

When comparing expression levels across different genetic backgrounds or tissues, it's critical to use appropriate housekeeping genes or proteins as internal controls to normalize expression data.

How does Abcd2 deficiency impact VLCFA metabolism in different tissues?

The impact of Abcd2 deficiency on VLCFA metabolism shows remarkable tissue specificity:

These tissue-specific effects highlight the importance of analyzing multiple tissues when characterizing Abcd2 function and potential therapeutic interventions.

What compensatory mechanisms occur when Abcd2 function is impaired?

When Abcd2 function is impaired, several compensatory mechanisms may be activated:

  • Upregulation of other transporters: Limited evidence suggests other peroxisomal transporters might be upregulated, though this compensation appears insufficient to prevent metabolic impairments in double Abcd1/Abcd2 deficiency .

  • Alternative metabolic pathways: Cells may partially adapt by utilizing alternative pathways for processing VLCFAs, though these are generally less efficient than peroxisomal β-oxidation.

  • Tissue-specific adaptations: The impact of Abcd2 deficiency varies significantly between tissues, suggesting that compensatory mechanisms differ based on tissue-specific metabolic requirements and expression patterns of related transporters .

  • No change in ELOVL1 expression: Interestingly, expression of Elovl1, the rate-limiting enzyme for VLCFA elongation, remains unchanged across different Abcd genotypes, indicating compensation does not involve downregulation of VLCFA synthesis .

Understanding these compensatory mechanisms may provide insights for developing therapeutic strategies for conditions involving impaired peroxisomal VLCFA metabolism.

What is the relationship between Abcd2 and peroxisomal β-oxidation of fatty acids?

Abcd2 plays a crucial role in facilitating peroxisomal β-oxidation by mediating the transport of VLCFAs into peroxisomes:

  • Transport function: As a peroxisomal membrane transporter, Abcd2 facilitates the entry of specific VLCFAs into peroxisomes where they can undergo β-oxidation . Without this transport, these fatty acids cannot access the peroxisomal matrix enzymes responsible for their degradation.

  • Functional redundancy with Abcd1: Experimental data shows Abcd2 can partially compensate for Abcd1 deficiency in terms of β-oxidation capacity. While Abcd1 deficiency reduces C26:0 β-oxidation to 62% of normal, additional loss of Abcd2 further decreases this activity to just 29% of wild-type levels .

  • Substrate specificity: Abcd2 likely has overlapping but distinct substrate preferences compared to Abcd1, potentially favoring different VLCFA species or other lipid substrates .

  • Specialized peroxisome subpopulations: The unique fractionation behavior of Abcd2 in adipose tissue suggests it may identify a specialized subclass of peroxisomes potentially dedicated to specific lipid metabolic functions .

This relationship highlights the importance of Abcd2 in maintaining lipid homeostasis through facilitating peroxisomal metabolic functions.

How might Abcd2 upregulation serve as a therapeutic strategy for X-ALD?

Upregulation of Abcd2 shows promise as a therapeutic strategy for X-linked adrenoleukodystrophy (X-ALD), a disorder caused by mutations in ABCD1:

  • Functional compensation: Overexpression of ABCD2 has been demonstrated to functionally compensate for ABCD1 deficiency in human X-ALD fibroblasts and Abcd1-deficient mice, correcting both impaired peroxisomal β-oxidation and VLCFA accumulation .

  • Endogenous compensation limitations: While endogenous Abcd2 provides some compensation in mouse models (explaining milder phenotypes compared to human X-ALD), its natural expression levels appear insufficient for complete rescue, particularly in critical tissues like brain where ABCD2 expression is low .

  • Pharmacological induction: Research is exploring pharmacological compounds that can induce ABCD2 expression. The ideal therapeutic would enhance ABCD2 expression in tissues relevant to X-ALD pathology, particularly the central nervous system.

  • Potential advantages: Upregulating an endogenous protein may present fewer immunological concerns than gene therapy approaches introducing ABCD1.

  • Challenges: Tissue-specific upregulation, achieving sufficient expression levels, and potential off-target effects of induction methods remain challenges for this therapeutic approach.

The evidence supporting ABCD2 upregulation as a therapeutic concept for X-ALD is strengthened by the marked worsening of metabolic phenotypes in Abcd1/Abcd2 double-deficient models compared to single Abcd1-deficient ones .

What are the specific differences in substrate specificity between Abcd1 and Abcd2?

While Abcd1 and Abcd2 have overlapping substrate specificities, important differences exist:

  • Experimental evidence: Studies using heterologous yeast expression systems have confirmed different but overlapping substrate specificities for ABCD1 and ABCD2 . These systems allow controlled evaluation of transporter function in a simplified cellular environment.

  • VLCFA preference: Abcd1 appears to preferentially transport saturated VLCFAs, while Abcd2 may have greater affinity for unsaturated or certain mono-unsaturated VLCFAs, though comprehensive substrate profiling remains incomplete.

  • Tissue-specific effects: In dorsal root ganglia, Abcd2 deficiency alone can lead to C26:0 accumulation, suggesting either unique substrate preferences in this tissue or tissue-specific expression patterns that make Abcd2 the predominant transporter .

  • Functional impacts: The substrate specificity differences explain why Abcd2 overexpression can compensate for Abcd1 deficiency, but endogenous levels may not be sufficient for complete rescue across all tissues.

  • Methodological approaches: Lipidomic analysis of tissues from single and double knockout models, combined with in vitro transport assays using purified proteins in reconstituted liposomes, can further elucidate these specificity differences.

Understanding these subtle differences in substrate preference may enable more targeted therapeutic approaches for disorders involving peroxisomal lipid metabolism.

What is the significance of Abcd2 identifying a subclass of peroxisomes in adipose tissue?

The discovery that Abcd2 identifies a potential subclass of peroxisomes in adipose tissue has several important implications:

  • Organelle heterogeneity: This finding challenges the conventional view of peroxisomes as homogeneous organelles, suggesting functional specialization among peroxisome subpopulations .

  • Unique fractionation behavior: Unlike in liver, where multiple peroxisomal markers co-fractionate, adipose tissue shows differential fractionation with Abcd2 pelleting in the light mitochondrial fraction (LMt) while other peroxisomal markers (catalase, PEX19, D3/PMP70) remain in suspension .

  • Protein associations: Proteomic analysis of Abcd2-containing compartments reveals associations with various peroxisomal, mitochondrial, and ER-related proteins, suggesting potential functional connections between these organelles .

  • Adipose-specific metabolism: This subclass may reflect adipose-specific metabolic requirements, potentially relating to specialized lipid processing functions in adipocytes.

  • Research implications: Investigators studying peroxisomal function in adipose tissue should consider this heterogeneity when designing isolation protocols and interpreting results, as conventional peroxisome isolation methods may not capture these Abcd2-containing structures.

This finding opens new research directions regarding organelle specialization and the role of peroxisome heterogeneity in tissue-specific metabolism.

What are the key considerations when designing primers for genotyping Abcd2 knockout mice?

Designing effective primers for genotyping Abcd2 knockout mice requires careful consideration of several factors:

  • Targeting strategy knowledge: Understanding the specific genetic modification used to create the knockout is essential. For example, in one common Abcd2 knockout model, part of the gene is replaced with a neomycin resistance gene (neo) .

  • Primer design specifications:

    • For wild-type allele detection: Forward primer 5′-TTCTAAGTGCCGCTGAGCATGC-3′ and reverse primer 5′-CTGCTGCATTTAGCATGTGTATC-3′, yielding a 466-bp PCR product

    • For knockout allele detection: Same forward primer with an alternative reverse primer 5′-CCATCTTGTTCAATGGCCGATC-3′ targeting the neo cassette, yielding a distinct product size

  • Multiplex PCR considerations: When designing a multiplex PCR to detect both wild-type and knockout alleles simultaneously, ensure primers have similar annealing temperatures and produce clearly distinguishable product sizes.

  • PCR optimization: Adjusting annealing temperature, magnesium concentration, and cycle number may be necessary to obtain clear, specific bands for reliable genotyping.

  • Quality control: Include positive controls (known wild-type, heterozygous, and homozygous samples) and negative controls (water) in each genotyping batch to ensure reliability.

These considerations ensure accurate genotyping, which is critical for maintaining colony integrity and experimental validity when working with Abcd2 knockout models.

How can researchers accurately measure peroxisomal β-oxidation activity in the context of Abcd2 studies?

Accurate measurement of peroxisomal β-oxidation activity is critical for functional studies of Abcd2:

  • Substrate selection: Using radiolabeled C26:0 or other relevant VLCFAs as substrates provides direct assessment of the pathway affected by Abcd2 function . The choice of substrate should reflect the specific research question regarding substrate specificity.

  • Tissue preparation: Fresh tissue homogenates or isolated cell populations (such as macrophages) can be used, with careful handling to preserve enzymatic activity .

  • Differentiation from mitochondrial β-oxidation: Include appropriate controls to distinguish peroxisomal β-oxidation from mitochondrial activity. This may involve using peroxisome-specific substrates or mitochondrial inhibitors.

  • Quantification methods: Measuring the production of radiolabeled acetyl-CoA or CO2 from labeled substrates provides quantitative assessment of β-oxidation capacity .

  • Comparative analysis: Always include appropriate controls (wild-type, Abcd1-deficient, Abcd2-deficient, and double-deficient samples) to assess the specific contribution of Abcd2 to the observed activity .

  • Data normalization: Normalize results to protein content, cell number, or tissue weight for accurate comparisons between samples and experimental conditions.

Using these approaches, researchers have demonstrated that Abcd1 deficiency reduces C26:0 β-oxidation to 62% of wild-type activity, while combined Abcd1/Abcd2 deficiency further reduces this to only 29% of normal activity .

What are the challenges in purifying recombinant Abcd2 protein for structural and functional studies?

Purification of recombinant Abcd2 protein presents several technical challenges:

  • Membrane protein expression: As a multi-spanning membrane protein, Abcd2 is difficult to express in soluble form. Expression systems must be carefully selected, with insect cells or specialized bacterial systems often providing better results than standard E. coli systems.

  • Protein folding and stability: Maintaining the native conformation during extraction and purification is challenging, requiring careful optimization of detergents or nanodiscs to mimic the membrane environment.

  • Functional assays: Verifying that purified Abcd2 retains transport activity requires reconstitution into liposomes or other membrane mimetics, followed by transport assays with appropriate substrates.

  • Protein-protein interactions: If Abcd2 functions as part of a complex, purification conditions must preserve these interactions or account for their absence.

  • Post-translational modifications: Ensuring that recombinant Abcd2 contains the appropriate post-translational modifications that might be essential for function or localization.

  • Species considerations: Mouse Abcd2 may have subtle structural or functional differences from human ABCD2, necessitating species-specific optimization of purification protocols.

These challenges explain why structural and comprehensive biochemical characterization of Abcd2 remains limited compared to some other ABC transporters. Advances in membrane protein structural biology, including cryo-electron microscopy, offer promising approaches to overcome these obstacles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.