Recombinant Mouse ATP-binding cassette sub-family D member 4 (Abcd4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ATP-Binding Cassette Sub-Family D Member 4 (ABCD4)

Recombinant Mouse ABCD4 is a lysosomal membrane transporter protein critical for cobalamin (vitamin B12) transport from lysosomes to the cytosol. It belongs to the ATP-binding cassette (ABC) transporter superfamily and functions as an ATP-dependent homodimer . This recombinant protein is widely used in biochemical studies, including cobalamin metabolism research and disease modeling of methylmalonic aciduria and homocystinuria .

Amino Acid Sequence and Domains

  • Full-length protein: Comprises 606 amino acids (AA 1-606), with a molecular weight of ~68.6 kDa .

  • Functional domains: Includes two nucleotide-binding domains (NBDs) and transmembrane domains (TMDs) essential for ATP hydrolysis and substrate transport .

  • Key residues:

    • Walker A motif (K427): Critical for ATPase activity; mutation (K427A) abolishes cobalamin transport .

    • Transmembrane helices (TM3, TM6): Mutations (N141K, Y319C) impair substrate recognition .

Expression and Purification

Recombinant Mouse ABCD4 is produced via:

Host SystemTagsPurityApplications
Tobacco (CFPS)Strep Tag>70-80%SDS-PAGE, Western Blot, ELISA
E. coliT7 + His Tag>95%IP, WB, ELISA
HEK-293 CellsMyc-DYKDDDDK Tag>80%Antibody blocking assays

Cobalamin Transport Mechanism

ABCD4 transports cobalamin in an ATP-dependent manner, as demonstrated by:

  1. Liposome reconstitution: Purified ABCD4 forms functional homodimers (~140 kDa) and exhibits ATPase activity proportional to intraliposomal cobalamin concentration .

  2. Mutational analysis:

    • K427A: Loss of ATPase activity prevents cobalamin release .

    • R432Q: Impairs Walker A motif function, reducing transport efficiency .

Disease-Associated Mutations

MutationImpactSource
N141KDisrupts TM3 structure, impairing substrate binding
Y319CAlters TM6 conformation, reducing ATPase activity
R432QDestabilizes Walker A motif, blocking ATP hydrolysis

Biochemical Assays

  • SDS-PAGE/Western Blot: Strep-tagged ABCD4 is used to detect lysosomal membrane integrity .

  • ELISA: Quantifies protein interactions or expression levels .

  • Immunoprecipitation (IP): Identifies ABCD4 binding partners (e.g., LMBRD1, MMACHC) .

Disease Modeling

ABCD4 knockdown or mutation models are utilized to study:

  • Cobalamin deficiency: Linked to methylmalonic aciduria and homocystinuria .

  • Peroxisomal disorders: ABCD4 interacts with peroxisomal ABC transporters (ABCD1-3) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Abcd4; Pxmp1l; Lysosomal cobalamin transporter ABCD4; ATP-binding cassette sub-family D member 4; PMP70-related protein; P70R; Peroxisomal membrane protein 1-like; PXMP1-L; Peroxisomal membrane protein 69; PMP69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Abcd4
Target Protein Sequence
MAVPGPTARAGARPRLDLQLVQRFVRIQKVFFPSWSSQNVLMFMTLLCVTLLEQLVIYQV GLIPSQYYGVLGNKDLDGFKALTLLAVTLIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLH HLYFRARVYYTLNVLRDDIDNPDQRISQDVERFCRQLSSVTSKLIISPFTLTYYTYQCFQ STGWLGPVSIFGYFIVGTMVNKTLMGPIVTKLVQQEKLEGDFRFKHMQIRVNAEPAAFYR AGLVEHMRTDRRLQRLLQTQRELMSRELWLYIGINTFDYLGSILSYVVIAIPIFSGVYGD LSPTELSTLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGELQEALLDMSRKSQD CEALGESEWDLDKTPGCPTTEPSDTAFLLDRVSILAPSSDKPLIKDLSLKICEGQSLLIT GNTGTGKTSLLRVLGGLWEGMKGSVQMLADFGPHGVLFLPQKPFFTDGTLREQVIYPLKE IYPDSGSADDERIVRFLELAGLSSLVARTGGLDQQVDWNWYDVLSPGEMQRLSFARLFYL QPKYAVLDEATSALTEEAESELYRIGQQLGMTFISVGHRPSLEKFHSWVLRLHGGGSWEL TRIKLE
Uniprot No.

Target Background

Function
This lysosomal membrane protein transports cobalamin (Vitamin B12) from the lysosomal lumen to the cytosol in an ATP-dependent manner. It is targeted by LMBRD1 lysosomal chaperone from the endoplasmic reticulum to the lysosomal membrane. Subsequently, it forms a complex with lysosomal chaperone LMBRD1 and cytosolic MMACHC to facilitate cobalamin transport across the lysosomal membrane.
Gene References Into Functions
  1. P70R resides in the ER but not the peroxisomal membranes, and the hydrophobic property of the NH(2)-terminal region determines the subcellular localization of ABC subfamily D proteins. PMID: 19010322
Database Links
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of mouse Abcd4?

Mouse Abcd4 is a member of the ATP-binding cassette (ABC) transporter superfamily, containing characteristic nucleotide-binding domains (NBDs) that bind and hydrolyze ATP. The protein is approximately 606 amino acids in length and has a molecular weight of approximately 70-75 kDa.

Functionally, Abcd4 was initially thought to be a peroxisomal membrane protein, but recent evidence suggests it is primarily localized to lysosomes. Unlike other ABCD family members that are involved in fatty acid transport across peroxisomal membranes, Abcd4 has been shown to transport vitamin B12 (cobalamin) across lysosomal membranes in an ATP-dependent manner .

The protein contains several functional domains:

  • Transmembrane domains that span the membrane

  • ATP-binding domains with ATPase activity

  • Substrate recognition sites

Research indicates that Abcd4 forms either homodimers or heterodimers with other transport proteins to create a functional transporter complex.

How does mouse Abcd4 differ from human ABCD4?

Mouse Abcd4 shares high sequence homology with human ABCD4 (approximately 80-85% identity at the amino acid level), suggesting conserved functions between species. Key differences include:

  • Minor variations in amino acid sequences, particularly in the substrate-binding regions

  • Slight differences in post-translational modifications

  • Potentially different tissue expression patterns

Despite these differences, functional studies have demonstrated that human ABCD4 can rescue phenotypes associated with Abcd4 deficiency in mouse models, indicating functional conservation across species .

Importantly, both mouse Abcd4 and human ABCD4 interact with LMBD1 (LMBRD1) protein in lysosomes, and this interaction is crucial for vitamin B12 transport. Mutations that disrupt this interaction in either species lead to vitamin B12 processing defects .

What are the optimal expression systems for producing recombinant mouse Abcd4?

Several expression systems have been successfully used to produce recombinant mouse Abcd4, each with distinct advantages:

E. coli expression systems:

  • Typically used for producing partial Abcd4 protein (e.g., amino acids 356-606 containing the ATP-binding domains)

  • Higher yield but may lack proper folding for the full-length protein

  • Suitable for structural studies of isolated domains

  • Protocols typically involve IPTG induction and His-tag purification

Mammalian cell expression (HEK-293 cells):

  • Preferred for full-length Abcd4 (amino acids 1-606)

  • Provides proper post-translational modifications and folding

  • Enables functional studies of the intact protein

  • Yields >90% purity as determined by Bis-Tris PAGE

Cell-free protein synthesis (CFPS):

  • Alternative approach for difficult-to-express membrane proteins

  • Allows for rapid production without cell culture

  • Yields approximately 70-80% purity

For functional studies, mammalian expression systems are generally recommended as they produce properly folded protein with native post-translational modifications.

What purification strategies yield the highest activity for recombinant mouse Abcd4?

Effective purification of functionally active recombinant mouse Abcd4 requires specific strategies to maintain protein integrity:

  • Affinity chromatography:

    • His-tag purification using Ni-NTA resin is most common

    • Strep-tag purification offers higher specificity and milder elution conditions

  • Buffer optimization:

    • Inclusion of glycerol (typically 5-50%) stabilizes the protein structure

    • PBS at pH 7.3-7.4 maintains optimal stability

    • Addition of protease inhibitors prevents degradation

  • Detergent selection:

    • Critical for solubilizing membrane-bound Abcd4

    • Mild detergents like DDM (n-Dodecyl β-D-maltoside) preserve ATPase activity

    • Detergent concentration should be maintained above CMC (critical micelle concentration)

  • Storage conditions:

    • Store purified protein at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • For long-term storage, aliquoting is recommended

Activity assays show that ATP hydrolysis activity is best preserved when the protein is purified with gentle detergent solubilization followed by affinity chromatography and size-exclusion chromatography to remove aggregates.

How can the ATPase activity of recombinant mouse Abcd4 be accurately measured?

The ATPase activity of recombinant mouse Abcd4 can be measured using several complementary approaches:

  • Colorimetric phosphate release assay:

    • Measures inorganic phosphate released during ATP hydrolysis

    • Malachite green or molybdate-based detection systems

    • Provides quantitative measurement of ATP hydrolysis rates

    • Sensitivity: can detect nanomolar amounts of released phosphate

  • Coupled enzyme assay:

    • Couples ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase

    • Allows real-time monitoring of ATPase activity

    • Less prone to interference from phosphate contaminants

  • Radioactive [γ-32P]ATP assay:

    • Measures release of radioactive phosphate from labeled ATP

    • Highest sensitivity but requires radioactive handling precautions

Research has shown that wild-type mouse Abcd4 exhibits basal ATPase activity that is significantly reduced in disease-associated mutants like N141K and Y319C . Mutations in the ATPase domain (such as L356P) show profound reduction in ATP hydrolysis, confirming the critical role of this domain in protein function.

For optimal results, assays should be performed at physiological pH (7.4) and temperature (37°C), with appropriate controls including ATPase inhibitors (e.g., vanadate) to confirm specificity.

What methods can be used to study vitamin B12 transport activity of recombinant mouse Abcd4?

To study the vitamin B12 transport activity of recombinant mouse Abcd4, researchers have employed several experimental approaches:

  • Liposome-based transport assays:

    • Abcd4 is reconstituted into liposomes with vitamin B12 (cobalamin) inside

    • Transport is measured as cobalamin efflux from liposomes

    • ATP-dependent transport can be confirmed by comparing activity with and without ATP

    • Research has shown that "ABCD4 was able to transport cobalamin from the inside to the outside of liposomes dependent on its ATPase activity"

  • Cell-based uptake assays:

    • Cells expressing recombinant Abcd4 are incubated with labeled vitamin B12

    • Transport activity is measured by cellular accumulation of labeled substrate

    • Comparing wild-type vs. mutant Abcd4 can reveal functional defects

  • Fluorescence-based assays:

    • Utilizing fluorescently labeled vitamin B12 analogues

    • Allows real-time monitoring of transport activity

    • Can be combined with confocal microscopy for spatial resolution

  • Co-immunoprecipitation with LMBD1:

    • Functional Abcd4 interacts with LMBD1 in lysosomes

    • This interaction is essential for vitamin B12 processing

    • Mutations that disrupt this interaction (such as N141K and Y319C) impair vitamin B12 transport

Using these methods, researchers have demonstrated that recombinant mouse Abcd4 transports vitamin B12 in an ATP-dependent manner, and this activity is abolished in disease-associated mutants.

How do disease-associated mutations affect the function of mouse Abcd4?

Several mutations in Abcd4 have been identified that impair protein function and are associated with vitamin B12 metabolism disorders. These mutations provide insights into structure-function relationships:

  • N141K mutation (Asn141Lys):

    • Located in a conserved region important for protein folding

    • Partially retains lysosomal localization but exhibits impaired interaction with LMBD1

    • Results in significantly reduced vitamin B12 transport activity

    • Associated with methylmalonic aciduria and homocystinuria, cblJ type

  • Y319C mutation (Tyr319Cys):

    • Located in a region involved in substrate recognition

    • Partially maintains lysosomal localization but shows reduced functional activity

    • Impairs interaction with LMBD1, crucial for vitamin B12 processing

    • Associated with cblJ disorder in patients

  • L356P mutation:

    • Located in the ATPase domain

    • "Abolishes ABCD4 function" by disrupting ATP binding

    • Molecular dynamics simulations based on cryo-EM structures confirm the mechanism

The study of these mutations in recombinant mouse Abcd4 has revealed critical structural elements required for proper function. Interestingly, some mutations affect protein folding and stability while others specifically disrupt ATP binding or substrate recognition without affecting protein expression.

MutationLocationFunctional EffectAssociated DisorderReference
N141K (p.Asn141Lys)Conserved regionImpaired LMBD1 interactioncblJ
Y319C (p.Tyr319Cys)Substrate recognition domainReduced transport activitycblJ
L356PATPase domainAbolished functionHearing loss

What are the experimental approaches to investigate Abcd4's role in hearing loss?

Recent research has implicated Abcd4 in inner ear function and hearing sensitivity. Experimental approaches to investigate this role include:

  • Knockout mouse models:

    • Abcd4 knockout mice exhibit increased auditory brainstem response threshold

    • Results in reduced hearing sensitivity

    • Provides in vivo evidence for Abcd4's role in auditory function

  • Zebrafish morpholino studies:

    • Suppression of Abcd4 expression in zebrafish using morpholinos

    • Reduces inner ear and lateral line hair cell numbers

    • Morphants lack the utricular otolith, associated with vestibular function

    • Human ABCD4 mRNA co-injection partially rescues the phenotype

  • Auditory brainstem response (ABR) testing:

    • Non-invasive measurement of hearing sensitivity

    • Reveals increased thresholds in Abcd4-deficient animals

    • Quantitative measure of hearing impairment

  • Histological analysis of inner ear structures:

    • Examines morphological changes in cochlear hair cells

    • Evaluates developmental defects in vestibular apparatus

    • Correlates structural abnormalities with functional impairment

These approaches have demonstrated that "Abcd4 knockout mice exhibit an increased auditory brainstem response threshold, resulting in reduced hearing sensitivity," suggesting that Abcd4 plays an important role in inner ear development and function .

How can recombinant mouse Abcd4 be used to study its role in mammary gland development?

Recent research has identified Abcd4 as a key player in mammary gland development in mammals. Experimental approaches to investigate this role include:

  • Overexpression and knockdown studies:

    • Overexpression of Abcd4 in HC11 mammary epithelial cells inhibits proliferation

    • Knockdown of Abcd4 shows opposite effects

    • Flow cytometric EdU analysis reveals that "overexpression of Abcd4 significantly inhibited cell proliferation"

    • Annexin-FITC/PI analysis indicates that "overexpression of Abcd4 significantly promoted HC11 apoptosis"

  • RNA-seq analysis:

    • Comparing transcriptomic profiles between control and Abcd4-overexpressing cells

    • Principal component analysis shows clear separation between experimental groups

    • Identifies differentially expressed genes (DEGs) - 203 up-regulated and 45 down-regulated

    • Reveals that "Abcd4 can induce widespread changes in the expression levels of genes involved in mammary gland development, such as Igfbp3, Ccl5, Tlr2, and Prlr"

  • Pathway analysis:

    • Functional enrichment analysis of DEGs

    • Identifies involvement in MAPK, JAK-STAT, and PI3K-AKT pathways

    • These pathways are crucial for mammary epithelial cell proliferation and differentiation

  • Single-cell RNA sequencing (scRNA-seq):

    • Characterizes expression profiles across mammary gland cell types

    • Reveals cell-specific expression patterns of Abcd4

    • Helps identify target cell populations for functional studies

These approaches provide comprehensive tools for investigating the molecular mechanisms by which Abcd4 influences mammary gland development and function.

What structural information is available for recombinant mouse Abcd4 and how can it be used for structure-based drug design?

Structural information about mouse Abcd4 is limited but growing:

This structural information can be used for structure-based drug design by:

  • Identifying druggable pockets within the protein structure

  • Computational screening of compound libraries against binding sites

  • Rational design of small molecules that could enhance or inhibit Abcd4 function

  • Development of compounds that could rescue function of disease-associated mutants

How can mouse Abcd4 be used as a control in ABCD family protein studies?

Mouse Abcd4 serves as a valuable control in studies of ABCD family proteins for several reasons:

  • Comparative functional analysis:

    • Unlike ABCD1, ABCD2, and ABCD3 that transport fatty acids in peroxisomes, Abcd4 primarily transports vitamin B12 in lysosomes

    • This functional divergence provides a negative control for peroxisomal fatty acid transport assays

    • Can help determine specificity of substrates and inhibitors for different ABCD transporters

  • Subcellular localization studies:

    • While most ABCD proteins localize to peroxisomes, Abcd4 localizes to lysosomes

    • Serves as a control for organelle-specific targeting mechanisms

    • Helps validate subcellular fractionation techniques and protein localization assays

  • Evolutionary conservation studies:

    • Sequence comparison between mouse Abcd4 and other ABCD proteins reveals conserved functional domains

    • Highlights unique features that determine substrate specificity and organelle targeting

    • Provides insights into evolutionary relationships within the ABC transporter superfamily

  • Cross-reactivity testing for antibodies:

    • Recombinant mouse Abcd4 can be used to test specificity of antibodies against ABCD family proteins

    • Helps identify cross-reactive antibodies that might give false positive results

    • Essential for accurate protein detection in immunological assays

Using recombinant mouse Abcd4 as a control facilitates more rigorous and reliable research on the broader ABCD protein family.

What are the methodological challenges in studying dimerization of recombinant mouse Abcd4?

Studying dimerization of recombinant mouse Abcd4 presents several methodological challenges:

  • Membrane protein solubilization:

    • Abcd4 is a membrane protein requiring detergent solubilization

    • Detergents may disrupt native protein-protein interactions

    • Finding detergents that maintain native dimeric state is challenging

    • Approaches include using mild detergents like DDM or nanodisc reconstitution

  • Native vs. recombinant systems:

    • Recombinant expression may alter dimerization properties

    • Overexpression can lead to non-physiological aggregation

    • Cell-specific post-translational modifications may affect dimerization

    • Comparing results from different expression systems is recommended

  • Detection methods:

    • Size-exclusion chromatography can separate monomers from dimers but may disrupt weak interactions

    • Blue native PAGE preserves native protein complexes but has limited resolution

    • Analytical ultracentrifugation provides accurate molecular weight determination but requires specialized equipment

    • Cross-linking mass spectrometry identifies interaction interfaces but may introduce artifacts

  • Functional correlation:

    • Establishing relationship between dimerization and function requires specialized assays

    • ATPase activity measurements in different oligomeric states

    • Transport assays using reconstituted proteins in liposomes

    • Mutagenesis of predicted dimerization interfaces to confirm functional relevance

Research suggests that ABCD family proteins typically function as dimers, with evidence pointing to both homodimeric and heterodimeric forms. Understanding these interactions is crucial for elucidating the functional mechanisms of Abcd4 in vitamin B12 transport.

How can Abcd4 data from the ABCD Study be effectively analyzed while accounting for design issues?

The Adolescent Brain Cognitive Development (ABCD) Study, though named similarly, is unrelated to the Abcd4 protein but presents important methodological considerations for large-scale biological data analysis that can be applied to Abcd4 research:

  • Addressing clustering and non-independence:

    • When analyzing Abcd4 expression or function across tissue samples or experimental conditions

    • Use multi-level modeling to account for within-subject correlations

    • Apply appropriate statistical controls for nested data structures

  • Sample weighting and selection bias:

    • When integrating Abcd4 data from multiple sources or studies

    • Consider propensity-based weighting adjustment methodology

    • Calibrate data to reference distributions when appropriate

  • Model-based vs. design-based approaches:

    • For Abcd4 functional studies, consider both:

      • Multi-level models that include appropriate statistical controls

      • Weighted estimates of descriptive statistics when combining datasets

    • Acknowledge assumptions in methodology descriptions

  • Handling design issues:

    • Design issues in experimental protocols can significantly impact data integrity

    • Identify and document potential confounding variables

    • Consider both prospective solutions (improved design) and retrospective solutions (analytical adjustments)

  • Computational modeling:

    • When contradictions arise in Abcd4 functional data

    • Develop new computational models that can capture violations in experimental design

    • Use simulations to validate analytical approaches

These methodological considerations are essential for generating reliable and reproducible findings in Abcd4 research, particularly when integrating data from multiple sources or experimental approaches.

What are the best practices for combining transcriptomic and functional data for comprehensive analysis of Abcd4?

Integrating transcriptomic and functional data provides a comprehensive understanding of Abcd4 biology. Best practices include:

  • Multi-omics data integration:

    • Correlate Abcd4 expression levels with protein abundance

    • Link expression changes to functional outcomes

    • Example: RNA-seq analysis of Abcd4-overexpressing HC11 cells revealed 248 differentially expressed genes, which correlated with observed changes in cell proliferation and apoptosis

  • Pathway-based analysis:

    • Map transcriptomic changes to known biological pathways

    • Identify upstream regulators and downstream effectors of Abcd4

    • Research has shown Abcd4 primarily affects genes "associated with the MAPK, JAK-STAT, and PI3K-AKT pathways"

  • Network analysis approaches:

    • Construct protein-protein interaction networks

    • Identify functional modules associated with Abcd4

    • Map interactions between Abcd4 and other proteins (e.g., LMBD1)

  • Time-course experiments:

    • Temporal profiling of transcriptomic and functional changes

    • Establish cause-effect relationships

    • Distinguish primary from secondary effects of Abcd4 modulation

  • Validation through multiple experimental approaches:

    • Confirm key findings using independent methods

    • Example workflow:

      1. Identify candidate genes from RNA-seq

      2. Validate using qPCR

      3. Confirm protein-level changes by Western blot

      4. Assess functional impact through targeted assays

  • Integrative visualization:

    • Create comprehensive visualizations that combine multiple data types

    • Use tools like Cytoscape for network visualization

    • Develop custom data dashboards for interactive exploration

This integrated approach has revealed that Abcd4 affects mammary epithelial cells by modulating the expression of key genes involved in development, proliferation, and apoptosis, providing a mechanistic understanding of its biological role.

How does recombinant tag choice affect the functionality and applications of mouse Abcd4?

The choice of recombinant tag significantly impacts the functionality and applications of mouse Abcd4:

  • His-tag (polyhistidine):

    • Most commonly used for Abcd4 purification

    • Enables purification using Ni-NTA affinity chromatography

    • Small size minimizes interference with protein folding

    • Available products include His-tagged mouse Abcd4 (AA 1-606 or AA 356-606)

    • Optimal for structural studies and most functional assays

  • Strep-tag:

    • Higher specificity than His-tag

    • Milder elution conditions preserve protein activity

    • Useful for pull-down assays and protein-protein interaction studies

    • Available as Strep-tagged mouse Abcd4 (AA 1-606)

    • Suitable for studying interactions with LMBD1 and other partners

  • T7-tag:

    • Often used in combination with His-tag

    • Facilitates detection in Western blots and immunoprecipitation

    • Available as T7-His-tagged mouse Abcd4 (AA 356-606)

    • Useful for expression validation and detection

  • Myc-DDK (FLAG) tag:

    • Enables highly specific immunoprecipitation

    • Useful for co-immunoprecipitation of interaction partners

    • Minimal interference with protein function

    • Available for human ABCD4 but principles apply to mouse Abcd4

Research considerations when selecting tags:

  • N-terminal vs. C-terminal placement affects function differently

  • Some tags may interfere with membrane insertion or organelle targeting

  • Tag removal options (protease cleavage sites) for native protein studies

  • Compatibility with desired detection methods and applications

The optimal tag choice depends on the specific research application, with His-tags being most versatile for purification and structural studies, while Strep-tags or FLAG-tags may be preferred for interaction studies.

What are the specific storage and handling requirements for maintaining the activity of recombinant mouse Abcd4?

Proper storage and handling are critical for maintaining the functional activity of recombinant mouse Abcd4:

  • Storage temperature:

    • Store at -20°C for short-term storage (up to 1 month)

    • Store at -80°C for long-term preservation (up to 12 months)

    • Avoid repeated freeze-thaw cycles that lead to protein denaturation

  • Buffer composition:

    • PBS at pH 7.3-7.4 provides optimal stability

    • Glycerol (5-50%) acts as a cryoprotectant and prevents aggregation

    • For some preparations, 0.01% SKL (sulfobetaine) and 5% trehalose improve stability

    • Protease inhibitors prevent degradation during storage

  • Aliquoting strategy:

    • Divide purified protein into single-use aliquots

    • Particularly important for proteins stored at higher concentrations

    • Prevents protein degradation from repeated freeze-thaw cycles

    • Recommended for -20°C storage

  • Reconstitution protocols:

    • Lyophilized recombinant mouse Abcd4 should be reconstituted carefully

    • For standard preparations: "Reconstitute at 10 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin"

    • For carrier-free preparations: "Reconstitute at 100 μg/mL in sterile PBS"

    • Gentle mixing without vortexing is recommended

  • Working with reconstituted protein:

    • Keep on ice when thawed for experiments

    • Use within 24 hours after thawing for optimal activity

    • For functional assays, maintain physiological conditions (pH 7.4, 37°C)

    • Avoid repeated freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.