Recombinant Mouse ATP-binding cassette sub-family G member 2 (Abcg2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Definition: Recombinant Mouse Abcg2 is a bacterially expressed protein (E. coli) comprising amino acids Leu63–Leu349 of the mouse Abcg2 gene (UniProt ID: Q7TMS5), fused with N-terminal His and T7 tags . It belongs to the "White" subfamily of ABC transporters, which mediate ATP-dependent efflux of substrates across cellular membranes .

Gene and Protein Details:

  • Gene ID: 26357 (Mus musculus)

  • Synonyms: Bcrp1, MXR1, ABCP, ABC15

  • Molecular Mass: Predicted 34.9 kDa (observed ~38 kDa due to post-translational modifications)

  • Isoelectric Point: 5.8

Role in Multidrug Resistance

  • Overexpression in cancer cells confers resistance to cytarabine, doxorubicin, and gemcitabine by enhancing drug efflux .

  • In nasal natural killer/T cell lymphoma, ABCG2 upregulation reduces apoptosis by suppressing pro-apoptotic proteins (Bax, caspase-3) and elevating anti-apoptotic BCL2 .

Stem Cell Identification

  • Abcg2 marks tissue-specific stem cells in hematopoiesis, intestinal crypts, and testes .

  • Lineage tracing in mice confirmed long-term retention of Abcg2+ hematopoietic stem cells (HSCs) contributing to blood cell renewal .

In Vivo Functional Studies

  • Xenograft models showed ABCG2-overexpressing tumors exhibit reduced sensitivity to gemcitabine, with 2.5-fold higher IC50 values compared to controls .

  • Knockdown via shRNA restored drug sensitivity and apoptosis in resistant cells .

Applications in Research

  • SDS-PAGE/Western Blot: Used to verify purity (>95%) and molecular weight .

  • Drug Resistance Assays: Evaluated via mitoxantrone efflux measurements .

  • Stem Cell Isolation: Antibodies like BXP-21 (ab3380) enable flow cytometric identification of Abcg2+ "side population" stem cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will prioritize developing the specified tag type if you have any specific requirements. Please inform us during your order.
Synonyms
Abcg2; Abcp; Bcrp1; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein 1 homolog; Urate exporter; CD antigen CD338
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-657
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSSSNDHVLVPMSQRNNNGLPRTNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCS GYVVQDDVVMGTLTVRENLQFSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQ FIRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELDQLPGAQEKKG TSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLP MRFLPSVIFTCVLYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLL MTIAFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDN STCVNSYAICTGNEYLINQGIELSPWGLWKNHVALACMIIIFLTIAYLKLLFLKKYS
Uniprot No.

Target Background

Function
ABCG2, an ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family, exhibits broad substrate specificity. It actively extrudes a wide range of physiological compounds, dietary toxins, and xenobiotics from cells. This protein plays a vital role in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from mitochondria to the cytosol and further to the extracellular space. It also facilitates heme export from cells. Additionally, ABCG2 is involved in the efflux of sphingosine-1-P from cells. Functioning as a urate exporter, ABCG2 contributes to both renal and extrarenal urate excretion. In the kidney, it further functions as a physiological exporter of the uremic toxin indoxyl sulfate. ABCG2 is also involved in the excretion of steroids, such as estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. This transporter mediates the secretion of riboflavin and biotin vitamins into milk. ABCG2 effectively removes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. It plays a crucial role in excluding xenobiotics from the brain. ABCG2 confers resistance to various drugs and xenobiotics, including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, by regulating their efflux. In the placenta, ABCG2 limits the penetration of drugs from maternal plasma into the fetus. The protein may also participate in early stem cell self-renewal by potentially blocking differentiation.
Gene References Into Functions
  1. ABCG2 is located in the blood-brain barrier and limits the entry of endogenous compounds and xenobiotics into the brain. Its expression and activity are regulated by estrogen. PMID: 29574357
  2. The hypothesis suggesting a fundamental role of ABCG2 in mESC differentiation or the influence of xenobiotics on this process could not be supported. PMID: 28990372
  3. Ultrasound has been shown to reverse chemoresistance in breast cancer stem cell-like cells by reducing ABCG2 expression. PMID: 28935760
  4. The findings suggest that EGFR-inhibiting drugs might induce ABCG2-mediated drug-drug interactions. PMID: 28790147
  5. Studies indicate that mdr1b and bcrp are crucial for ovarian protection from chemotoxicity and may play a significant physiological role in the ovary. PMID: 28216407
  6. ABCG2 deficiency in the skin impairs re-epithelialization during cutaneous wound healing. PMID: 26739701
  7. MDR1 and BCRP are expressed on apical membranes of the rodent placental SynT-II layer. PMID: 27616577
  8. Bcrp1 (Abcg2), the murine orthologue of the ABC transporter Breast Cancer Resistance Protein (BCRP, ABCG2), has at least four alternative promoters that produce four alternative first exons: E1U, E1A, E1B, and E1C. In-silico protocols are presented to predict alternative promoter usage for Bcrp1. PMID: 27286290
  9. New pyrimido[1'',2'':1,5]pyrazolo[3,4-b]quinolones have been identified that reverse ABCG2-mediated resistance in cancer cells. PMID: 27012188
  10. [(18)F]Mefway is modulated by P-gp, but not by Bcrp in rodents. PMID: 26250653
  11. P-gp, Bcrp, Mrp1, and Mrp4 are differentially expressed at the outer and inner blood retinal barrier, resulting in an altered ability to limit substrate distribution at the retina compared to the blood-brain barrier. PMID: 26507673
  12. Coadministration of ceritinib with a dual ABCB1 and ABCG2 inhibitor might improve the treatment of brain (micro) metastases. PMID: 26361725
  13. The Pparalpha complex translocates from the cytoplasm into the nucleus and further recruits coactivators and transcription machinery, which induce the transcription of Abcg2 gene. This ultimately leads to upregulation of Bcrp protein expression and function. PMID: 26465636
  14. Among the ABC drug transporters, only ABCG2 exhibited highly increased levels in a mouse G3 medulloblastoma model. PMID: 26199091
  15. The studies using Bcrp KO mice provide an estimation of the clinical plasma concentration-time curve changes in ABCG2 421C>A variants for BCRP substrate drugs. The F ratio corrects the systemic clearance change by Bcrp knockout in Bcrp KO mice. PMID: 25380981
  16. Renal urate excretion was increased in Abcg2-knockout mice. PMID: 24940679
  17. Data demonstrate that brain penetration of ABT-888 in both Abcb1a/1b-/- and Abcb1a/1b-/-;Abcg2-/- mice was significantly higher compared to wild-type mice. PMID: 24647572
  18. Expression profiling of mRNA isoforms revealed that E1b is predominantly expressed and induced in the lactating mammary gland. E1b promoter sequences in the virgin gland are already hypomethylated and marked with the open chromatin histone mark H3K4me2. PMID: 25117410
  19. Abcg2 plays a cytoprotective role in response to in vivo oxidative stress. PMID: 24727496
  20. CYT387 was efficiently transported by both human MDR1 and BCRP, and very efficiently by mouse Bcrp1. Its transport could be inhibited by specific MDR1 inhibitor, zosuquidar and/or specific BCRP inhibitor, Ko143. PMID: 23827160
  21. Inhibitors demonstrated similar effects on human and mouse ABCG2. PMID: 23868912
  22. This hypoxia-induced ERK 1/2-dependent ABCG2 expression results in resistance to H/R injury, partially explaining the mechanism by which ABCG2 contributes to cellular protection in kidney SP cells. PMID: 23032069
  23. This effect was observed in Bcrp1;Mrp2;Mrp3(-/-), but not Bcrp1;Mdr1a/b;Mrp(-/-) mice. PMID: 24334255
  24. Bioluminescent imaging of drug efflux at the blood-brain barrier mediated by the transporter ABCG2 has been achieved. PMID: 24297888
  25. Nuclear transcription factor SF-1 is involved in the regulation of a novel promoter of Bcrp1 that governs transcription of the E1U mRNA isoform in mice. PMID: 24189494
  26. Both p-glycoprotein and breast cancer resistance protein restrict brain access for several antiepileptic drugs, providing valuable insights for developing treatments for refractory epilepsy. PMID: 23588114
  27. Data suggest that Abcc4 limits the brain penetration of camptothecin analogues and collaborates with Abcb1a/b and Abcg2 to form a robust cooperative drug efflux system. PMID: 23461902
  28. The finding that ABCG2 deficiency can generate dysfunctional mitochondria in hepatocytes raises concerns regarding the systemic use of ABCG2 inhibitors in cancer patients. PMID: 23954234
  29. Expression and function of the BCRP drug transporter in AB cells have been characterized. PMID: 23298861
  30. Abcg2 deficiency increases oxidative stress and alters inflammatory response in the brain, exacerbating cognitive/memory deficit in double-tg mice at different developmental stages. PMID: 22578166
  31. P-glycoprotein (Mdr1a/1b) and breast cancer resistance protein (Bcrp) decrease the uptake of hydrophobic alkyl triphenylphosphonium cations by the brain. PMID: 23454352
  32. Results indicate that the potency and specificity of sildenafil as an inhibitor of ABCB1 and ABCG2 are not sufficient to warrant further clinical testing of this agent in combination with anticancer drugs. PMID: 23422148
  33. Bcrp plays a significant role in the efflux of (11)C-SC-62807 in the liver and kidney. PMID: 23287578
  34. It can be concluded that BCRP plays an important role in the intestinal efflux of MED-5 and limits its bioavailability after oral administration of MED-15. PMID: 23333829
  35. Abcg2 modulates cardiac side population cell cycle progression and asymmetric cell division, establishing a mechanistic link between this surface transporter and cardiac progenitor cell function. PMID: 23136123
  36. ABCG2 determines the distribution of genistein phase II metabolites and bioavailability. PMID: 22736306
  37. A positron emission tomography (PET) protocol has been developed to visualize Bcrp function at the murine blood-brain barrier. PMID: 22828996
  38. Results demonstrate that ABCG2 limits the systemic exposure to numerous phytoestrogens by directing their sulfate conjugates for excretion via the feces. PMID: 22707564
  39. Lack of ABCG2 shortens the latency of BRCA1-deficient mammary tumors. PMID: 22767648
  40. Localization of BCRP in endocrine organs along with the efficient allosteric inhibition of the efflux pump by steroid hormones suggest a potential role for BCRP in steroid hormone regulation. PMID: 22581381
  41. Intracellular accumulation of vemurafenib is significantly restricted due to active efflux by P-gp(ABCB1) and BCRP(ABCG2). PMID: 22454535
  42. Assessment of activity, exploratory behavior, and anxiety levels revealed behavioral alterations in Abcb1(0/0) and Abcc1 (0/0) mice, while Abcg2(0/0) mice were mostly unaffected. PMID: 22545122
  43. The circadian clock-ATF4 pathway appears to enhance the function of BCRP during a specific time window and modulate intestinal drug absorption. PMID: 22396548
  44. Both P-gp and Bcrp1 reduce the brain penetration of erlotinib. PMID: 20963470
  45. PDZK1 plays a crucial role in the apical localization of BCRP. PMID: 21816982
  46. A direct and conclusive Bcrp1 efflux action on phase II metabolites of these isoflavones in vivo suggests a novel concept for ABCG2/BCRP as part of metabolism-driven efflux transport of these conjugates. PMID: 21828252
  47. The expression levels of ABCG2 transcripts were significantly decreased in denervated eyes. PMID: 22232434
  48. ABCG2 and BMI-1 are predictors of the transformation of oral leukoplakia to cancer. PMID: 22009787
  49. ABCG2 protects against pressure overload-induced cardiac hypertrophy and heart failure by promoting angiogenesis and antioxidant response. PMID: 22116099
  50. The capacity and regulation of breast cancer resistance protein (BCRP)-mediated transport in intact human intestinal epithelial monolayers have been investigated. PMID: 22004608

Show More

Hide All

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in kidney. Lower expression in liver, colon, heart, spleen, and placenta. Expressed in mammary gland. Expressed in intestinal villi and renal proximal tubules, hepatic bile canalicular membranes, and placental labyrinth cells (at protein

Q&A

What is Recombinant Mouse ATP-binding cassette sub-family G member 2 (Abcg2) and what is its function?

Recombinant Mouse Abcg2 is a laboratory-produced version of the native Abcg2 protein, engineered for research purposes. Abcg2 belongs to the superfamily of ATP-binding cassette (ABC) transporters that actively pump various molecules across cellular membranes against their concentration gradient, using ATP hydrolysis as an energy source. In its functional form, Abcg2 operates as a homodimer weighing approximately 144 kDa with nucleotide-binding domains (NBDs) towards the N-terminus that bind ATP molecules . The protein is highly conserved across species, indicating its biological significance.

Functionally, Abcg2 serves as an efflux transporter that pumps a wide range of substrates out of cells, including xenobiotics, porphyrins, and cellular metabolites. It plays crucial roles in multiple biological processes including: protection against xenobiotics, maintenance of redox homeostasis in stem cells, contribution to multidrug resistance mechanisms in cancer cells, and regulation of cellular homeostasis in various tissues . Evidence supports that Abcg2 helps maintain redox homeostasis in embryonic stem cells, particularly during conditions of clonal expansion or xenobiotic stress .

How does Abcg2 expression differ across mouse tissues and developmental stages?

Abcg2 expression exhibits significant tissue-specific and developmental stage-dependent patterns. During early embryonic development, Abcg2 is highly expressed in mouse embryonic stem cells (mESCs), where it provides protection against environmental stressors and maintains stemness characteristics . As development progresses, expression becomes more restricted to specific tissues and cell types.

In adult mice, high Abcg2 expression is found in:

  • Blood-tissue barriers (blood-brain barrier, blood-testis barrier, blood-placental barrier)

  • Excretory organs (liver and kidney)

  • Intestinal epithelium

  • Mammary gland during lactation

  • Hematopoietic stem cells

What are the common methods for detecting Abcg2 expression in mouse models?

Several methodologies are employed to detect and quantify Abcg2 expression in mouse models, each with specific advantages depending on the research question:

Protein Detection Methods:

  • Western blotting using specific anti-Abcg2 antibodies (as referenced in manuscript figure 4b)

  • Immunohistochemistry/Immunofluorescence for tissue localization

  • Flow cytometry using fluorescently-labeled antibodies against Abcg2 (CD338)

  • Functional assays using fluorescent Abcg2 substrates like Pheophorbide A (PhA) (as referenced in manuscript figure 4a)

Gene Expression Methods:

  • Quantitative real-time PCR (qRT-PCR) for Abcg2 mRNA quantification

  • RNA-Seq for transcriptome-wide analysis

  • In situ hybridization for spatial expression patterns

Reporter Systems:

  • Transgenic mice expressing fluorescent proteins under the Abcg2 promoter

  • Knock-in reporter systems where Abcg2 is tagged with a detectable marker

Functional Assays:

  • Side population analysis based on Hoechst 33342 efflux

  • RedDot1 fluorescence assays that monitor Abcg2 activity during differentiation

  • Transport assays using specific substrates with and without inhibitors

Protein-level detection methods provide information about functional transporter levels, while gene expression methods offer insights into transcriptional regulation. The choice of method depends on whether researchers need to assess expression levels, localization, or functional activity of the transporter.

How does mouse Abcg2 compare structurally and functionally to human ABCG2?

Mouse Abcg2 and human ABCG2 share significant structural and functional similarities, making mouse models valuable for studying ABCG2-related biology and pathology:

Structural Similarities:

  • Both form functional homodimers with similar molecular weights

  • Both contain conserved nucleotide-binding domains (NBDs) and transmembrane domains (TMDs)

  • High sequence homology, particularly in the NBD and TMD regions which are critical for function

  • Similar substrate binding pocket in the large central cavity with preference for flat, polycyclic compounds with hydrophobic characteristics

Functional Similarities:

  • Both transport a similar spectrum of substrates

  • Both use ATP hydrolysis to drive conformational changes needed for transport

  • Both contribute to multidrug resistance mechanisms

  • Both play roles in redox homeostasis and protection against xenobiotics

Key Differences:

  • Some species-specific substrate affinities exist

  • Minor differences in tissue distribution patterns

  • Some regulatory elements in gene promoters differ

  • Differences in post-translational modifications may affect activity

Despite these differences, mouse Abcg2 is considered a good model for human ABCG2 in most research applications, with approximately 80-85% sequence identity between the two proteins. This conservation underscores the biological importance of this transporter across species and supports the use of mouse models for translational research.

What are the key substrates of mouse Abcg2?

Mouse Abcg2 transports a diverse range of substrates, with strongest affinity for flat, polycyclic compounds with hydrophobic characteristics . Key substrates include:

Endogenous Compounds:

  • Porphyrins and heme precursors

  • Folic acid and its derivatives

  • Sulfated hormone metabolites (e.g., estrone-3-sulfate)

  • Uric acid

  • Glutathione and its conjugates

Xenobiotics:

  • Chemotherapeutic drugs (mitoxantrone, topotecan, irinotecan, methotrexate)

  • Tyrosine kinase inhibitors

  • Fluorescent dyes (Hoechst 33342, BODIPY-prazosin)

  • Antibiotics (ciprofloxacin, norfloxacin)

  • Environmental toxins and pollutants

Experimental Probes:

  • RedDot1 (as referenced in manuscript figures 3a, 6a, and 7a)

  • Pheophorbide A (PhA) (as referenced in manuscript figure 4a)

Substrate binding occurs in the large central cavity of the Abcg2 dimer. The binding pocket accommodates compounds with planar structures containing multiple aromatic rings particularly well, explaining why many chemotherapeutic agents are Abcg2 substrates . This broad substrate specificity contributes to Abcg2's important role in cellular defense against xenobiotics and in maintaining cellular homeostasis.

What are the optimal experimental conditions for studying Abcg2 function in mouse embryonic stem cells?

Optimal experimental conditions for studying Abcg2 function in mouse embryonic stem cells (mESCs) require careful attention to multiple factors:

Cell Culture Conditions:

  • Maintenance medium: DMEM supplemented with LIF (leukemia inhibitory factor), 2-mercaptoethanol, and either serum or defined supplements

  • Feeder-free culture systems using gelatin or Matrigel coating to avoid interference from feeder cells

  • Controlled oxygen tension (hypoxic conditions may affect Abcg2 expression)

  • Careful passaging protocols to maintain stemness

Differentiation Protocols:

  • For studying changes during differentiation, employ embryoid body formation or directed differentiation protocols

  • Critical assessment points during days 1-4 of differentiation when major changes in Abcg2 expression occur

  • Time-course studies rather than single time points to capture dynamic changes

Functional Assays:

  • Efflux assays using fluorescent substrates (e.g., Pheophorbide A, RedDot1) with and without specific Abcg2 inhibitors

  • Flow cytometry to monitor the side population phenotype

  • RedDot1 fluorescence assays for monitoring Abcg2 activity in real-time

Controls and Validation:

  • Use of specific Abcg2 inhibitors (e.g., Ko143) as positive controls

  • Comparison with Abcg2 knockout or knockdown models

  • Monitoring of stem cell markers (Oct4, Nanog, Sox2) alongside Abcg2 to correlate with differentiation status

These conditions ensure reliable and reproducible results when investigating Abcg2 function in the context of mESC biology, particularly when studying its role in xenobiotic response and redox homeostasis during early differentiation.

How does Abcg2 contribute to redox homeostasis during mouse embryonic stem cell differentiation?

Abcg2 plays a crucial role in maintaining redox homeostasis during mouse embryonic stem cell (mESC) differentiation, particularly during conditions of clonal expansion or xenobiotic stress . This function is vital for stem cell survival and proper differentiation.

Mechanisms of Redox Regulation:

  • Abcg2 effluxes harmful oxidative metabolites and xenobiotics that could disrupt the redox balance

  • It exports porphyrins and their metabolites, preventing accumulation that could lead to reactive oxygen species (ROS) generation

  • Abcg2 may indirectly regulate glutathione levels by transporting glutathione conjugates

  • It helps maintain the appropriate intracellular environment for pluripotency factors

Evidence from Experimental Studies:

  • Studies show that Abcg2 expression correlates with resistance to oxidative stress in mESCs

  • Inhibition of Abcg2 leads to increased sensitivity to oxidative stressors like tert-butyl hydroperoxide (TBHP)

  • During xenobiotic exposure, Abcg2 function becomes particularly important for maintaining stem cell viability

Temporal Dynamics:

  • Abcg2 expression and function change dynamically during differentiation

  • These changes correlate with alterations in the cellular redox state as cells transition from pluripotency to lineage commitment

  • The highest expression typically occurs in the pluripotent state, providing maximum protection during this vulnerable stage

This redox regulatory function supports a broader understanding of how stem cells maintain their integrity in challenging environments and during the complex process of differentiation. The findings support Abcg2's role in maintaining redox homeostasis specifically during conditions of clonal expansion or xenobiotic stress .

What techniques are most effective for measuring Abcg2-mediated efflux activity in mouse cell models?

Several techniques have proven effective for measuring Abcg2-mediated efflux activity in mouse cell models, each with specific advantages:

Flow Cytometry-Based Assays:

  • Substrate Accumulation Assays: Cells are incubated with fluorescent Abcg2 substrates (e.g., Pheophorbide A, Hoechst 33342) with and without specific Abcg2 inhibitors. The difference in fluorescence indicates Abcg2 transport activity .

  • Side Population (SP) Assay: Based on Abcg2's ability to efflux Hoechst 33342, creating a distinct "side population" of cells with low dye retention on flow cytometry.

  • Real-time Efflux Assays: Monitoring the kinetics of substrate efflux over time provides detailed information about transporter function.

Microscopy-Based Methods:

  • Live-cell Imaging: Using confocal microscopy to track the accumulation and efflux of fluorescent substrates in real-time.

  • High-Content Imaging: Automated microscopy systems that can quantify substrate accumulation across many cells simultaneously.

Biochemical Approaches:

  • ATPase Assays: Measuring ATP hydrolysis rates as an indirect measure of transport activity.

  • Vesicular Transport Assays: Using membrane vesicles prepared from Abcg2-expressing cells to study substrate transport in a controlled system.

Advanced Methodologies:

  • RedDot1 Fluorescence Assays: As described in the research data, this provides a sensitive measure of Abcg2 activity in mESCs .

  • Combining Functional Assays with Protein Quantification: Correlating transport activity with protein levels determined by Western blotting or other protein quantification methods (as in manuscript figure 4b) .

The choice of technique depends on the specific research question, with flow cytometry-based methods offering high throughput and microscopy-based methods providing spatial information about transporter activity. Combined approaches that integrate multiple techniques provide the most comprehensive assessment of Abcg2 function.

How do xenobiotics influence Abcg2 expression and function during early mouse development?

Xenobiotics can significantly influence Abcg2 expression and function during early mouse development, with important implications for embryonic protection and proper development:

Effects on Abcg2 Expression:

  • Many xenobiotics upregulate Abcg2 expression as a protective response

  • This regulation often occurs through transcription factors like AhR (aryl hydrocarbon receptor), Nrf2, and hypoxia-inducible factors

  • Research indicates that ToxCast chemicals can alter Abcg2 expression during mESC differentiation

  • The timing of exposure is critical, with early developmental stages showing particular sensitivity

Functional Consequences:

  • Xenobiotic exposure can modify Abcg2 transport activity, affecting the cell's ability to efflux toxins

  • Some compounds may act as competitive or non-competitive inhibitors of Abcg2

  • Others may serve as substrates, inducing transporter activity

  • Altered Abcg2 function can impact cellular redox status, particularly during stem cell differentiation

Developmental Implications:

  • Disruption of normal Abcg2 function during critical developmental windows may affect stem cell maintenance

  • Changes in Abcg2 activity can alter the cellular microenvironment, potentially affecting differentiation trajectories

  • The protective function of Abcg2 becomes particularly important during xenobiotic challenge, helping maintain redox homeostasis

Experimental Evidence:

  • Studies have shown differential responses to xenobiotics across days of embryonic stem cell differentiation (as referenced in manuscript figures 6a and 6b)

  • Oxidative stressors like tert-butyl hydroperoxide (TBHP) can affect Abcg2-dependent cellular responses (as referenced in manuscript figure 7a)

This complex relationship between xenobiotics and Abcg2 highlights the importance of this transporter in developmental toxicology and embryonic protection mechanisms. Understanding these interactions is crucial for assessing potential developmental risks of environmental chemicals.

What are the challenges and solutions in generating Abcg2 knockout or knockdown mouse models?

Generating and working with Abcg2 knockout or knockdown mouse models presents several challenges, along with potential solutions:

Technical Challenges in Model Generation:

  • Embryonic Lethality: Complete Abcg2 knockout may affect embryonic development due to its role in stem cell maintenance and protection.

    • Solution: Conditional knockout systems using Cre-loxP technology to control temporal and tissue-specific deletion.

  • Compensatory Mechanisms: Other ABC transporters may upregulate to compensate for Abcg2 loss.

    • Solution: Generate combination knockouts or use pharmacological inhibitors of multiple transporters alongside genetic models.

  • Genetic Background Effects: The phenotype of Abcg2 deficiency can vary with the genetic background of mice.

    • Solution: Backcross to establish congenic strains or use multiple genetic backgrounds for comprehensive analysis.

  • Knockdown Efficiency: siRNA or shRNA approaches may yield incomplete knockdown.

    • Solution: CRISPR/Cas9 technology for more efficient gene editing or use of multiple knockdown constructs targeting different regions.

Phenotyping Challenges:

  • Subtle Phenotypes: Abcg2 knockout may produce subtle phenotypes that require specialized detection methods.

    • Solution: Comprehensive phenotyping including functional assays, challenges with Abcg2 substrates, and exposure to xenobiotics or oxidative stress conditions.

  • Developmental Timing: Effects may be stage-specific during development.

    • Solution: Time-course analyses across developmental stages, particularly focusing on early embryonic development and stem cell differentiation.

  • Tissue-Specific Effects: Abcg2 function varies across tissues.

    • Solution: Targeted analysis of tissues with high Abcg2 expression and tissue-specific conditional knockouts.

These strategies can help researchers overcome the challenges associated with developing and utilizing Abcg2 knockout or knockdown mouse models for studying this important transporter's functions, particularly in contexts like embryonic stem cell differentiation where Abcg2 plays crucial protective roles .

How does Abcg2 interact with other ABC transporters in multidrug resistance mechanisms?

Abcg2 operates within a complex network of ABC transporters that collectively contribute to multidrug resistance. Understanding these interactions is crucial for comprehensive studies of resistance mechanisms:

Functional Overlap and Compensation:

  • Abcg2 shares substrate specificity with other ABC transporters, particularly P-glycoprotein (ABCB1) and MRP1 (ABCC1)

  • When one transporter is inhibited or downregulated, others may compensate through upregulation

  • This functional redundancy creates challenges for targeting ABC transporters in multidrug resistance

Co-expression Patterns:

Synergistic Effects:

  • Multiple ABC transporters can work together to enhance drug efflux

  • Some compounds require sequential processing by different transporters

  • This cooperation creates a more robust defense against a wider range of xenobiotics

Regulatory Interactions:

  • ABC transporters often share transcriptional regulation mechanisms

  • Xenobiotic exposure frequently induces multiple transporters simultaneously

  • Common regulatory pathways include PXR, CAR, and Nrf2 transcription factors

Experimental Approaches to Study Interactions:

  • Use of multiple specific inhibitors to block different transporters individually and in combination

  • Generation of double or triple knockout models

  • Transcriptome analysis to identify coordinated expression patterns

  • Transport assays with substrates specific for different transporters

Understanding how Abcg2 interacts with other ABC transporters is essential for developing strategies to overcome multidrug resistance in cancer. Compounds like masitinib that can antagonize multiple ABC transporters represent promising approaches for addressing these complex resistance mechanisms .

What are the latest methodologies for studying Abcg2 homodimerization and its effect on transport activity?

Recent advances have expanded the methodologies available for studying Abcg2 homodimerization and its relationship to transport function:

Structural Biology Approaches:

  • Cryo-electron microscopy (Cryo-EM): Provides high-resolution structural information about Abcg2 dimers in different conformational states

  • X-ray crystallography: Can capture stable conformations of the dimerized transporter

  • Molecular dynamics simulations: Complement experimental structures by modeling dynamic aspects of dimerization

Biophysical Techniques:

  • Förster resonance energy transfer (FRET): Detects protein-protein interactions by measuring energy transfer between fluorophore-tagged Abcg2 monomers

  • Bioluminescence resonance energy transfer (BRET): Similar to FRET but uses luminescence instead of fluorescence

  • Fluorescence correlation spectroscopy (FCS): Analyzes the diffusion behavior of fluorescently labeled Abcg2 to determine oligomerization state

Biochemical Methods:

  • Chemical cross-linking coupled with mass spectrometry: Identifies specific residues involved in dimer interfaces

  • Co-immunoprecipitation with differentially tagged monomers: Confirms physical interaction between Abcg2 monomers

  • Blue native PAGE: Separates intact protein complexes under native conditions to preserve dimeric structures

Functional Correlation Approaches:

  • Site-directed mutagenesis of dimerization interfaces: Assesses how specific residues contribute to dimer formation and stability

  • Transport assays with dimerization-defective mutants: Links structural changes to functional outcomes

  • Split-protein complementation assays: Monitors dimerization in living cells through reconstitution of a reporter protein

These methodologies collectively provide complementary information about Abcg2 homodimerization, which is essential for its transport activity . Understanding the structural basis and dynamics of dimerization provides insights into how Abcg2 functions and how it might be targeted in therapeutic contexts.

How can researchers differentiate between Abcg2-specific effects and those mediated by other ABC transporters in experimental settings?

Differentiating Abcg2-specific effects from those mediated by other ABC transporters requires systematic approaches:

Pharmacological Approaches:

  • Selective Inhibitors: Use highly selective Abcg2 inhibitors like Ko143, which has ~200-fold selectivity for Abcg2 over P-glycoprotein

  • Inhibitor Panels: Employ a panel of inhibitors specific for different ABC transporters (e.g., verapamil for P-glycoprotein, MK-571 for MRPs)

  • Titration Studies: Conduct dose-response experiments with inhibitors to identify concentration ranges with transporter selectivity

  • Substrate Specificity: Utilize substrates preferentially transported by Abcg2 (e.g., mitoxantrone, pheophorbide A)

Genetic Approaches:

  • Knockout/Knockdown Models: Generate Abcg2-specific knockout or knockdown models while confirming other transporters remain unaffected

  • Overexpression Systems: Create cell lines overexpressing only Abcg2 through stable transfection

  • CRISPR/Cas9 Gene Editing: Introduce specific mutations or deletions in Abcg2 without affecting other transporters

  • Rescue Experiments: Reintroduce wild-type Abcg2 into knockout models to confirm phenotype reversal

Analytical Methods:

  • Transporter Expression Profiling: Quantify expression levels of multiple ABC transporters simultaneously using qPCR or proteomics

  • Transport Kinetics Analysis: Determine kinetic parameters (Km, Vmax) for substrate transport, which can differ between transporters

  • Fluorescent Substrate Assays: Use flow cytometry with fluorescent substrates in the presence of specific inhibitors

By employing these strategies, researchers can more confidently attribute observed effects specifically to Abcg2 rather than to other ABC transporters with overlapping functions. This is particularly important when studying complex phenomena like multidrug resistance, where multiple transporters may contribute to the observed phenotype .

What experimental approaches are recommended for studying Abcg2's role in stem cell maintenance and differentiation?

Studying Abcg2's role in stem cell maintenance and differentiation requires integrated experimental approaches:

Cell Culture Systems:

  • Mouse Embryonic Stem Cell (mESC) Models: Utilize established mESC lines with characterized Abcg2 expression

  • Controlled Differentiation Protocols: Employ standardized methods for inducing differentiation (embryoid body formation, directed differentiation protocols)

  • Co-culture Systems: Examine Abcg2 function in the context of supportive cell types that may influence stem cell behavior

  • 3D Culture Models: Use organoid cultures to better mimic the in vivo environment

Functional Assessment Techniques:

  • Side Population Analysis: Identify stem cells based on Abcg2-mediated Hoechst 33342 efflux

  • RedDot1 Fluorescence Assays: Monitor Abcg2 activity during differentiation

  • Clonogenic Assays: Assess self-renewal capacity in relation to Abcg2 expression

  • Lineage Tracing: Track the fate of Abcg2-expressing cells during differentiation

Molecular and Genetic Approaches:

  • Time-course Expression Analysis: Monitor changes in Abcg2 expression across differentiation stages

  • ChIP-Seq Analysis: Identify transcription factors regulating Abcg2 during differentiation

  • CRISPR/Cas9 Modifications: Generate Abcg2 knockout or mutant stem cell lines

  • Inducible Expression Systems: Control Abcg2 expression at specific differentiation stages

Stress Response Evaluation:

  • Oxidative Stress Challenges: Expose cells to oxidative stressors like tert-butyl hydroperoxide (TBHP) to assess Abcg2's protective role

  • Xenobiotic Exposure: Test the impact of various xenobiotics on Abcg2 function and stem cell maintenance

  • Hypoxia Experiments: Examine Abcg2 function under low oxygen conditions that mimic stem cell niches

These approaches collectively provide a comprehensive framework for understanding how Abcg2 contributes to stem cell biology, particularly its role in maintaining redox homeostasis during embryonic stem cell differentiation and in response to xenobiotic stress .

How can researchers effectively use recombinant mouse Abcg2 in drug resistance studies?

Researchers can effectively utilize recombinant mouse Abcg2 in drug resistance studies through the following approaches:

Production and Purification:

  • Expression Systems: Utilize mammalian, insect, or yeast expression systems to produce functional recombinant Abcg2

  • Purification Strategies: Employ affinity tags (His, FLAG, etc.) for purification while ensuring retention of function

  • Quality Control: Validate protein folding, dimerization, and ATPase activity before experimental use

Experimental Systems:

  • Proteoliposomes: Reconstitute purified Abcg2 into lipid vesicles for transport studies in a defined environment

  • Stable Cell Lines: Generate cell lines with controlled expression of recombinant Abcg2

  • Transient Transfection: Introduce Abcg2 expression vectors for short-term studies

  • Vesicular Transport Assays: Use inside-out membrane vesicles prepared from Abcg2-expressing cells

Functional Characterization:

  • Substrate Profiling: Systematically assess transport of potential drug substrates

  • Inhibitor Screening: Identify compounds that modulate Abcg2 activity, such as masitinib

  • ATPase Assays: Measure ATP hydrolysis rates as an indicator of transporter activity

  • Transport Kinetics: Determine Km and Vmax values for different substrates

Drug Resistance Applications:

  • Cytotoxicity Assays: Compare drug sensitivity between Abcg2-expressing and control cells

  • Combination Studies: Evaluate Abcg2 inhibitors in combination with chemotherapeutic agents

  • Structure-Activity Relationships: Correlate drug molecular features with Abcg2 transport efficiency

  • Resistance Mechanism Studies: Distinguish Abcg2-mediated resistance from other mechanisms

By implementing these strategies, researchers can effectively utilize recombinant mouse Abcg2 to study drug resistance mechanisms, screen for modulators of transporter activity, and develop strategies to overcome Abcg2-mediated multidrug resistance in cancer and other diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.