Recombinant Mouse ATP-binding cassette sub-family G member 3 (Abcg3)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions and Pathways

Abcg3 participates in ATP-dependent transport mechanisms, with biochemical activities including:

  • ATP hydrolysis coupled to substrate translocation

  • Drug transmembrane transport, particularly for hydrophobic compounds

  • Potential involvement in cholesterol homeostasis (inferred from ABCG family homology)

Pathways associated with Abcg3 (Creative BioMart ):

PathwayKey Co-expressed Proteins
ABC transportersABCA1, ABCB7, ABCC5, ABCG2
Lipid metabolismABCG5, ABCG8 (via functional homology)

Protein Interaction Studies

Abcg3 interacts with cytoskeletal regulators and signaling molecules, including:

  • Cfl1 (Cofilin-1): Modulates actin dynamics near membrane transporters

  • Cdc42: Regulates polarized vesicle trafficking

  • Slc9a3r1 (NHERF1): Scaffold protein linking transporters to signaling networks

Disease Relevance

  • Atherosclerosis: Linked to ABC transporter dysfunction in cholesterol efflux

  • Drug resistance: Structural homology with ABCG2 suggests potential roles in xenobiotic clearance

Detection and Quantification Tools

The Mouse Abcg3 ELISA Kit (Assay Genie MOEB2304) enables sensitive quantification in biological samples :

ParameterSpecification
Detection Range0.312–20 ng/mL
Sensitivity0.179 ng/mL
Intra-assay CV6.2%
Inter-assay CV7.8%
Sample TypesSerum, plasma, cell lysates

Dimerization Requirement

Functional studies suggest Abcg3 requires heterodimerization with another ABCG subunit for transporter activity, as it lacks intrinsic ATP-binding capability . This contrasts with ABCG2, which functions as a homodimer .

Tissue-Specific Expression

High expression levels in immune organs (thymus, spleen) imply roles in:

  • Peptide antigen presentation

  • Lymphocyte lipid metabolism

Open Questions and Future Directions

  1. Substrate specificity: No direct ligands have been validated experimentally.

  2. Regulatory mechanisms: Transcriptional control elements remain uncharacterized.

  3. Therapeutic targeting: Potential for modulating Abcg3 in metabolic disorders requires in vivo validation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Abcg3; ATP-binding cassette sub-family G member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-650
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Abcg3
Target Protein Sequence
MASNNDPTVISMIERHLCDLPETNTSDLKTLTEEAVLSFHNISYQETVQSGFPLRKKAYV IERLSNISGIMKPGLNAIMGPQDGSRSLLLDVLAARRDPRGLSGDILINGKPRPANFKCT SGYVPQNDVVLGTVTVRDNLEFSAALRLPVTITRDEKRRRINEVLELLHLNKEQNIKPRS KELRKRTSIAMELVTEHPILFLDDPTTGLDLRTTTDVILVLRRMSKKGRTIIFSINQPQY SIFKFFDSLTLVASGKVMFHGPAQDALEYFRSAGYNYESHNNPADFFLDVINGGFSNILD TEEDGHEDDKYEELFERQYQVTGKLANMYAQSPLYSETRAILDQLLGEQKLERSSAVETT CVTPFCHQLKWIICQSFKNFKGFPWVTVIQAIITVILATAVGTAFRVLKNDCIEVQMRAG LLYLLTIFQCITSVSAGELFVIDRVRFLHEHTSGYYRVSSYFFGKLLAELIPRRLLPSTV FSLITYVIAGVKMSMKCFFTMICTIMVLAYSASSLPLSIGAGENAVAVPTLLVTIYFVFM LFFSGLSLYSGSFLPKLSWIQYFSIPHYGFRALLHNEFLGQNFCPEHNTEEVSRCHNYVI CTGEEFLMIQGIDLSSWGFWENHLALVCTMIILLTITYVQLLQVKNIRNF
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highest levels of expression in thymus and spleen. Detected in lung and small intestine.

Q&A

What is the molecular structure and function of Recombinant Mouse Abcg3?

Recombinant Mouse ATP-binding cassette sub-family G member a (Abcg3) is a transmembrane protein belonging to the ABC transporter family. As a functional ATP-binding transporter, Abcg3 exhibits several biochemical activities including ATP binding, ATPase activity, and ATPase activity coupled to transmembrane movement of substances. The protein plays a critical role in the ATP-dependent transport of various molecules across cellular membranes. From a structural perspective, Abcg3 contains characteristic nucleotide-binding domains that interact with ATP, and transmembrane domains that form the pathway through which substrates are transported across membranes .

What are the common expression systems used for producing Recombinant Mouse Abcg3?

Multiple expression systems can be employed to produce Recombinant Mouse Abcg3, each with distinct advantages depending on research requirements. The most common expression systems include:

Expression HostTag OptionsProtein CharacteristicsResearch Applications
Mammalian CellsHisNative-like post-translational modificationsFunctional studies, antibody production
HEK293Avi, Fc, HisEnhanced solubility and foldingProtein interaction studies
E. coliHisFull Length (1-650)Structural studies, high yield production

How does Abcg3 function within the context of ABC transporters pathway?

Abcg3 operates within the broader ABC transporters pathway, working alongside related proteins to facilitate the ATP-dependent membrane transport of various substrates. Within this pathway, Abcg3 coordinates with other proteins including ABCG2, ABCB10, ABCA3, ABCB7, CFTR, Abca2, ABCA13, ABCD3A, ABCA1, and TAP1 . The functional capacity of Abcg3 particularly relates to drug transmembrane transporter activity, positioning it as a potentially significant protein in xenobiotic transport and cellular detoxification processes. Research methodologies for studying Abcg3's role in this pathway typically involve knockout models, transporter assays, and fluorescently labeled substrate tracking to measure transport kinetics and substrate specificity .

What are the optimal conditions for expressing and purifying functional Recombinant Mouse Abcg3?

Optimizing expression and purification of functional Recombinant Mouse Abcg3 requires careful attention to several factors. When working with mammalian expression systems, transfection efficiency and expression levels can be maximized by:

  • Maintaining cells at optimal confluence (70-80%) during transfection

  • Using serum-free, antibiotic-free media during the transfection process

  • Implementing temperature shifts (reducing to 30-32°C post-transfection)

  • Adding chemical chaperones to enhance proper folding

For purification, a multi-step approach typically yields the best results:

  • Initial capture using immobilized metal affinity chromatography (IMAC) if the protein contains a His-tag

  • Intermediate purification with ion exchange chromatography

  • Final polishing with size exclusion chromatography to separate monomeric protein from aggregates

Detergent selection is crucial for maintaining Abcg3 functionality during purification, with mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) often providing the best balance between protein solubilization and activity preservation. Activity assays post-purification, such as ATPase assays, should be performed to confirm that the purified protein retains its functional properties .

How can researchers effectively study the drug transport activity of Recombinant Mouse Abcg3 in vitro?

Investigating the drug transport activity of Recombinant Mouse Abcg3 in vitro requires specialized methodological approaches:

  • Inside-out membrane vesicle assays: Prepare membrane vesicles from cells expressing Abcg3, then measure ATP-dependent uptake of fluorescent or radioactively labeled substrates into these vesicles

  • Reconstitution into proteoliposomes: Purified Abcg3 can be incorporated into artificial lipid bilayers to study transport kinetics in a defined lipid environment

  • Cell-based transport assays: Generate stable cell lines expressing Abcg3 and measure the differential accumulation of potential substrates compared to control cells

  • ATPase activity coupling: Measure ATP hydrolysis rates in the presence of various compounds to identify potential substrates or inhibitors

For quantitative analysis, researchers should implement proper controls including ATPase-deficient mutants (e.g., mutations in the Walker A or B motifs) to distinguish between specific transport and passive diffusion. Additionally, competitive inhibition studies with known ABC transporter substrates can help characterize the substrate specificity profile of Abcg3 .

What approaches are recommended for investigating Abcg3 protein-protein interactions in a physiological context?

Investigating Abcg3 protein-protein interactions requires methods that preserve physiological relevance while providing sufficient sensitivity:

  • Proximity-based labeling: BioID or APEX2 fusion proteins can identify proximal proteins in living cells

  • Co-immunoprecipitation with crosslinking: Capturing transient interactions using membrane-permeable crosslinkers before cell lysis

  • Fluorescence resonance energy transfer (FRET): For studying interactions in living cells with minimal disruption

  • Split-protein complementation assays: Such as split-luciferase or split-GFP systems to detect interactions in cellular contexts

  • Bimolecular fluorescence complementation (BiFC): To visualize the subcellular localization of protein interactions

Known interaction partners for Abcg3 include Agr2, Ppia, Cfl1, Cdc42, Pfn1, Slc9a3r1, Anxa4, Ces1e, Lgals4, Anxa13, Lgals2, and Dstn . When designing interaction studies, researchers should consider using magnetic beads coupled to recombinant Abcg3 for pull-down experiments, similar to the pre-coupled magnetic beads available for research purposes (product ABCG3-208M-B) .

How can researchers address the common challenges in expressing full-length Recombinant Mouse Abcg3?

Expression of full-length Recombinant Mouse Abcg3 presents several technical challenges due to its transmembrane domains and complex structure. Researchers can implement the following methodological solutions:

  • Expression vector optimization:

    • Use strong, inducible promoters with fine control over expression levels

    • Include Kozak consensus sequences for efficient translation initiation

    • Consider codon optimization for the expression system being used

  • Membrane protein stabilization strategies:

    • Co-express with molecular chaperones (e.g., Hsp70, Hsp90)

    • Include stabilizing mutations identified through alanine scanning or directed evolution

    • Use fusion partners (e.g., GFP, MBP) that enhance folding and stability

  • Cell growth and induction conditions:

    • Implement slow induction protocols (reduced temperature, lower inducer concentration)

    • Supplement growth media with specific lipids or chemical chaperones

  • Extraction and solubilization:

    • Screen multiple detergents and detergent:protein ratios

    • Consider detergent mixtures or newer amphipathic polymers (e.g., SMALPs)

    • Implement lipid supplementation during extraction

For E. coli-based expression of full-length Abcg3 (1-650), specialized bacterial strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard BL21(DE3) strains .

What controls should be implemented when studying Abcg3 transport activity to distinguish between passive and active transport?

To rigorously characterize Abcg3 transport activity, researchers must implement several controls that distinguish between ATP-dependent active transport and passive movement:

  • ATP dependency controls:

    • Conduct parallel assays with ATP vs. non-hydrolyzable ATP analogs (AMP-PNP, ATP-γ-S)

    • Include experiments with ATP-free conditions

    • Implement vanadate inhibition studies (vanadate traps ABC transporters in post-hydrolysis state)

  • Mutant controls:

    • Generate transport-deficient mutants through mutations in:

      • Walker A motif (K→M mutation) - prevents ATP binding

      • Walker B motif (D→N mutation) - permits ATP binding but prevents hydrolysis

      • Q-loop mutations - disrupts communication between nucleotide binding and transmembrane domains

    • Compare transport rates between wild-type and mutant proteins

  • Temperature dependency:

    • Conduct assays at multiple temperatures (4°C, 25°C, 37°C)

    • Active transport shows strong temperature dependence, while passive diffusion exhibits lower temperature sensitivity

  • Concentration gradient controls:

    • Reverse concentration gradients to determine directionality dependence

    • Measure transport rates at different substrate concentrations to distinguish facilitated diffusion from active transport

These methodological controls are essential for accurately characterizing the transport mechanisms of Abcg3 and differentiating its activity from other cellular processes that might affect substrate distribution .

How can researchers address the issue of low protein yield when expressing Recombinant Mouse Abcg3?

Low protein yield is a common challenge when expressing membrane proteins like Abcg3. Researchers can implement several methodological approaches to improve yields:

  • Expression system optimization:

    • Consider switching between prokaryotic and eukaryotic systems based on construct requirements

    • For mammalian expression, test different cell lines (HEK293, CHO, Expi293)

    • Evaluate both transient and stable expression approaches

  • Construct design strategies:

    • Test truncated constructs that remove potentially disordered regions

    • Create chimeric constructs with well-expressed homologs

    • Implement systematic N- and C-terminal truncations to identify optimal constructs

  • Culture condition optimization:

    • Supplement media with specific additives (e.g., heme for cytochrome-containing proteins)

    • Implement feed strategies for higher density cultures

    • Optimize induction timing based on growth phase

  • Recovery enhancement:

    • Screen multiple lysis buffers with varied detergent compositions

    • Implement batch binding steps before column chromatography

    • Consider on-column refolding for proteins expressed in inclusion bodies

  • Scale-up strategies:

    • Transition from shake flasks to bioreactors for improved control

    • Implement perfusion systems for continuous culture

    • Optimize harvest timing based on expression kinetics analysis

For E. coli-expressed full-length Abcg3, researchers report better yields when using specialized strains and auto-induction media, combined with extraction using detergent mixtures rather than single detergents .

How does Recombinant Mouse Abcg3 compare functionally to other ABC transporters in drug resistance studies?

Recombinant Mouse Abcg3 exhibits distinct functional characteristics compared to other ABC transporters involved in drug resistance:

TransporterSubstrate SpecificityTissue ExpressionRole in Drug Resistance
Abcg3Drug transmembrane transportVariable across tissuesUnder investigation
ABCG2/BCRPBroad specificity, anticancer drugsPlacenta, intestine, liverWell-established in MDR
ABCB1/P-gpHydrophobic compoundsIntestine, liver, kidney, BBBPrimary MDR mediator
ABCC1/MRP1Conjugated organic anionsUbiquitousSecond-line MDR

Methodologically, when comparing Abcg3 to other transporters, researchers should:

  • Conduct parallel transport assays using identical substrate panels across multiple transporters

  • Implement comparative genomics and structural modeling to identify unique features in the substrate-binding pocket

  • Perform cross-inhibition studies to determine overlapping substrate specificities

  • Generate chimeric proteins between Abcg3 and other ABC transporters to map functional domains

The drug transmembrane transporter activity of Abcg3 suggests potential functional overlap with transporters like ABCG2A, Abcb1b, and SLC22A5, warranting careful experimental design when studying specificity .

What roles does Abcg3 play in physiological functions beyond drug transport?

Beyond drug transport, Abcg3 participates in several physiological processes:

  • Lipid homeostasis:

    • ABC transporters in the G subfamily often transport lipids and sterols

    • Abcg3 may participate in specific lipid transport pathways, affecting membrane composition

  • Cellular detoxification:

    • Removal of endogenous metabolites and xenobiotics

    • Protection against oxidative stress through transport of glutathione conjugates

  • Signaling pathway modulation:

    • Potential roles in distributing signaling molecules across membranes

    • Indirect effects on pathway activity through alterations in membrane lipid composition

  • Development and differentiation:

    • Expression patterns suggest tissue-specific roles during development

    • Possible contributions to establishing and maintaining stem cell niches

Research methodologies to investigate these non-drug transport functions include:

  • Lipidomic profiling of membranes in Abcg3-deficient models

  • Metabolomic analysis of cells with altered Abcg3 expression

  • Developmental staging studies in knockout models

  • Pathway analysis using phosphoproteomics after Abcg3 modulation

These physiological functions may provide insight into why Abcg3 interacts with proteins involved in cytoskeletal regulation (Cfl1, Pfn1, Dstn) and calcium signaling pathways .

How can researchers interpret contradictory data regarding Abcg3 substrate specificity?

Contradictory findings regarding Abcg3 substrate specificity are common in the literature. Researchers can employ several methodological approaches to resolve these contradictions:

  • Experimental system standardization:

    • Compare results obtained in different expression systems (insect cells, mammalian cells)

    • Standardize membrane preparation protocols across laboratories

    • Establish common positive and negative controls for transport assays

  • Transport assay normalization:

    • Account for differences in protein expression levels

    • Normalize transport activity to ATPase activity

    • Develop standardized activity units for cross-laboratory comparison

  • Substrate interaction analysis:

    • Distinguish between transported substrates and modulators of transport activity

    • Implement binding studies to determine direct interactions

    • Use competition assays to map binding sites

  • Concentration-dependent effects:

    • Test wide concentration ranges to identify biphasic effects

    • Account for substrate aggregation at high concentrations

    • Consider microenvironment effects (pH, membrane composition)

  • Meta-analysis approaches:

    • Compile results across studies with statistical weighting for methodological rigor

    • Identify patterns in contradictory results that suggest context-dependent activity

    • Develop predictive models incorporating multiple datasets

When evaluating contradictory findings, researchers should also consider potential post-translational modifications of Abcg3 that might alter substrate specificity in different experimental systems or physiological contexts .

What are the key biochemical properties of Recombinant Mouse Abcg3 relevant to research applications?

The biochemical properties of Recombinant Mouse Abcg3 significantly impact experimental design and interpretation:

PropertyCharacteristicResearch Implication
Molecular WeightVariable based on tag (Full length ~70 kDa)Affects migration patterns in SDS-PAGE
Oligomeric StateLikely homodimeric or higherRequires non-denaturing conditions for functional studies
Post-translational ModificationsPotential glycosylation, phosphorylationExpression system selection is critical
ATP Binding AffinityKD typically in low μM rangeInfluences concentration requirements in ATPase assays
ATPase ActivityPresent intrinsically, enhanced by substratesUseful for indirect substrate screening
pH StabilityTypically stable between pH 6.5-8.5Buffer selection for purification and functional assays
Temperature StabilityVariable, influenced by detergent/lipid environmentStorage and assay temperature considerations

For research applications requiring preserved ATPase activity, protein formulations typically include stabilizing factors like glycerol (10-20%), specific lipids, and carefully selected detergents. These biochemical properties guide experimental design considerations, particularly for researchers studying ATPase activity, coupled to transmembrane movement of substances .

What experimental approaches can identify the endogenous substrates of Abcg3?

Identifying endogenous substrates of Abcg3 requires a comprehensive approach combining multiple experimental techniques:

  • Untargeted screening methods:

    • Metabolomic profiling comparing wild-type and Abcg3-deficient samples

    • Inside-out vesicle uptake assays coupled with mass spectrometry

    • Differential metabolite analysis after Abcg3 inhibition/knockdown

  • In silico prediction approaches:

    • Pharmacophore modeling based on known ABC transporter substrates

    • Molecular docking using homology models of Abcg3

    • Machine learning algorithms trained on established substrate datasets

  • Direct binding assays:

    • Surface plasmon resonance with immobilized Abcg3

    • Fluorescence-based thermal shift assays to detect ligand-induced stabilization

    • Isothermal titration calorimetry for binding affinity determination

  • Functional verification:

    • Correlation between binding and transport/ATPase stimulation

    • Competitive inhibition studies with candidate substrates

    • Transport assays in cellular systems with varying Abcg3 expression

These approaches should be applied systematically, starting with broad screens and progressively focusing on candidate substrates that demonstrate consistent evidence across multiple experimental paradigms. Researchers should particularly consider molecules involved in the pathways where Abcg3 interacting partners (such as Agr2, Ppia, and others) are active .

How do post-translational modifications affect Abcg3 function and experimental results?

Post-translational modifications (PTMs) can significantly impact Abcg3 function and experimental outcomes:

  • Phosphorylation effects:

    • Potential sites include serine/threonine residues in regulatory domains

    • May alter ATPase activity, substrate specificity, or protein-protein interactions

    • Methodological approach: Compare activity of phosphomimetic (S/T→D/E) and phosphodeficient (S/T→A) mutants

  • Glycosylation considerations:

    • N-linked glycosylation may affect protein stability and trafficking

    • Impact on activity depends on glycosylation site location relative to functional domains

    • Methodological approach: Express in systems with different glycosylation capabilities (E. coli vs. mammalian cells)

  • Ubiquitination implications:

    • Regulates protein turnover and potentially acute activity regulation

    • May signal for internalization from plasma membrane

    • Methodological approach: Study ubiquitination patterns under different conditions using ubiquitin-specific antibodies

  • PTM interplay:

    • Cross-talk between different modifications can create complex regulatory networks

    • Specific modification patterns may create unique functional states

    • Methodological approach: Systematic mutation of modification sites individually and in combination

When designing experiments, researchers should consider:

  • The native PTM profile in the biological system under investigation

  • Whether the expression system used for recombinant production can reproduce relevant PTMs

  • The impact of purification methods on PTM preservation

  • The potential need for enzymatic treatments to generate specific PTM states

These considerations are particularly important when studying Abcg3 expressed in different systems, such as E. coli versus mammalian cells, which would result in different PTM profiles that could affect experimental outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.