Recombinant Mouse ATP-binding cassette sub-family G member 5 (Abcg5)

Shipped with Ice Packs
In Stock

Description

Key Functional Domains:

  • Walker A Motif: Essential for ATP binding; deletion disrupts sterol transport .

  • Glycosylation Sites: Critical for protein maturation and ER-to-plasma membrane trafficking .

Research Findings from Knockout Models

Disruption of Abcg5 and Abcg8 in mice (G5G8−/−) revealed:

PhenotypeMechanismCitation
Accumulation of Dietary SterolsLoss of biliary cholesterol excretion
Reduced Biliary Cholesterol30-50% decrease vs. wild-type mice
Hepatic Cholesterol RetentionImpaired reverse cholesterol transport

These findings underscore the complex's role in preventing sitosterolemia, a condition characterized by pathological sterol accumulation .

Applications in Biomedical Research

  • Sterol Metabolism Studies: Used to investigate mechanisms of cholesterol homeostasis and atherosclerosis .

  • Drug Development: Target for therapies addressing sitosterolemia and lipid disorders .

  • Protein Interaction Assays: Co-immunoprecipitation studies validate heterodimer formation .

Technical Considerations

  • Storage Stability: Lyophilized powder retains activity for 12 months at -80°C; reconstituted aliquots are stable for 1 week at 4°C .

  • Activity Assays: ATPase activity measured via Mg²⁺-dependent ATP hydrolysis in membrane fractions .

Related Proteins and Orthologs

SpeciesRecombinant ProductApplication
RatABCG5-70R (His-Fc-Avi tag)Cholesterol flux assays
ZebrafishABCG5-6981ZEvolutionary studies
HumanABCG5 (Q9H222)Disease modeling

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-652
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGELPFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVSYSVSNRVGPWWNIKS CQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCFSYVLQSDVFLSSLTVRETLRYTAMLALCRSSADFYNKKVEAVMTELSLSH VADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQIVLLLAELA RRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKILENIERARYLKTLPTVPFKTK DPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGLFLIFYLLRVQNNTLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYHKWQMLLAYVLHVLPFSVIAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSIVALLSI SGLLIGSGFIRNIQEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSMLNHPM CAITQGVQFIEKTCPGATSRFTANFLILYGFIPALVILGIVIFKVRDYLISR
Uniprot No.

Target Background

Function
ABCG5 and ABCG8 form an obligatory heterodimer responsible for Mg(2+)- and ATP-dependent sterol transport across cell membranes. This heterodimer plays a crucial role in the selective transport of dietary plant sterols and cholesterol within and out of enterocytes and in the selective excretion of sterols from the liver into bile. It is essential for maintaining normal sterol homeostasis. The heterodimer with ABCG8 exhibits ATPase activity.
Gene References Into Functions
  1. ABCG5 and ABCG8 mRNA levels were significantly elevated in the cholesterol group and showed a lesser increase in the myriocin group compared to the normal group. PMID: 28268212
  2. The ABCG5/G8-independent pathway plays a significant role in regulating biliary cholesterol secretion and gallstone formation, operating independently of the ABCG5/G8 pathway. PMID: 27014967
  3. ABCG5/G8 mediate mass biliary cholesterol secretion, but not from a pool relevant to reverse cholesterol transport. PMID: 26520893
  4. AdGRP78 reduced expression of lipogenic genes and plasma triglycerides in the db/db strain. Both G5 and G8 protein levels increased, as did total biliary cholesterol. PMID: 26365598
  5. The data demonstrate that Abcg5/Abcg8 deficiency reduces the uptake and secretion of both dietary triacylglycerols and cholesterol by the intestine, suggesting a novel role for the sterol transporter in the formation and secretion of chylomicrons. PMID: 25676339
  6. Sitosterolemia is caused by a genetic defect of sterolins (ABCG5/ABCG8) mapped to the STSL locus. Polymorphic variations in STSL have been linked to lipid levels and gallstone disease. PMID: 24811295
  7. The absence of ABCG5/ABCG8 expression. PMID: 25060694
  8. Mice with deficient Abcg2 exhibit features of inflammatory DCM, and the reversibility of myocardial T cell infiltration provides a novel model for investigating the progression of myocardial fibrosis. PMID: 23129576
  9. Biliary cholesterol mass secretion under maximal bile salt-stimulated conditions is fully dependent on ABCG5/G8. PMID: 23401258
  10. This study is the first to report such toxic effects of phytosterol accumulation in ABCG5/G8 knockout mice. PMID: 23380580
  11. The ability of triiodothyronine to stimulate the secretion of cholesterol into bile is largely mediated by the ABCG5/G8 complex. PMID: 22829162
  12. Sterol handling by the intestine involves both G5G8 and ACAT2, but an additional factor (possibly Niemann-Pick C1-like 1) may be crucial in determining absorption efficiency. PMID: 22669916
  13. The ABCG5 ABCG8 sterol transporter opposes the development of fatty liver disease and loss of glycemic control independently of phytosterol accumulation. PMID: 22715101
  14. ABCG5/G8 deficiency in mice markedly raises triglyceride levels by impairing triglyceride catabolism and increasing liver and intestinal triglyceride secretion. PMID: 21855652
  15. NPC2 is a positive regulator of biliary cholesterol secretion through stimulation of ABCG5/G8-mediated cholesterol transport. PMID: 21315718
  16. NBD1, although not required for ATP hydrolysis, is essential for normal function of G5G8 in sterol transport. PMID: 21209088
  17. Disruption in the Abcg5 gene is associated with thrombocytopenia and cardiomyopathy. PMID: 19846887
  18. Regulation by liver X receptors alpha and beta. PMID: 11901146
  19. While a large number of polymorphic variants were identified, strains reported to show significant differences in cholesterol absorption rates did not exhibit significant genomic variations in Abcg5 or Abcg8. PMID: 11907139
  20. Biliary cholesterol secretion mediated by ABCG5 and ABCG8. PMID: 12208859
  21. Expression, dimerization, and transport of ABCG5 and ABCG8. PMID: 12208867
  22. ABCG5 and ABCG8 are required for efficient secretion of cholesterol into bile. Disruption of these genes dramatically increases the responsiveness of plasma and hepatic cholesterol levels to changes in dietary cholesterol content. PMID: 12444248
  23. A role for Abcg5 and Abcg8 in regulating biliary cholesterol secretion. Additionally, the existence of a largely independent route of cholesterol secretion. PMID: 12763362
  24. Endotoxin significantly decreased mRNA levels of ABCG5 and ABCG8 in the liver, but not in the small intestine. PMID: 12777468
  25. ABCG5 and ABCG8 function as obligate heterodimers to promote sterol excretion into bile. PMID: 14504269
  26. Disruption of the Abcg5 gene alone is sufficient to cause hyperabsorption of dietary plant sterols and sitosterolemia in mice, while the ability to secrete cholesterol into bile is maintained. PMID: 14699507
  27. Abcg5 and Abcg8 in the jejunum and ileum, but not in the duodenum, were primary factors in determining variations in Ch absorption efficiency. PMID: 15102882
  28. The PERA allele of Abcg5/Abcg8, on chromosome 17, is responsible for lithogenicity underlying the Lith9 cholelithiasis QTL. PMID: 16151694
  29. Aging significantly enhances cholesterol absorption by suppressing expression of the jejunal and ileal sterol efflux transporter Abcg5. PMID: 16179600
  30. Our data confirm that Abcg5, as part of the Abcg5/Abcg8 heterodimer, strongly controls hepatobiliary cholesterol secretion in mice. PMID: 16614371
  31. G5 and G8 are sufficient for reconstitution of sterol transfer activity in vitro and provide the first demonstration that sterols are direct transport substrates of the G5 and G8 heterodimer. PMID: 16867993
  32. Distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis in abcg5 transgenic mice. PMID: 17060690
  33. Levels of the ABCG5-ABCG8 sterol transporter in the liver are regulated by the leptin axis. PMID: 17561514
  34. Cholesterol secretion was highly bile salt-dependent, while other cholesterol acceptors such as ApoAI, HDL, or methyl-beta-cyclodextrin did not elicit Abcg5/g8 dependent cholesterol secretion. PMID: 17825296
  35. Mutations in either ABCG5 or ABCG8 cause sitosterolemia, an inborn error of metabolism characterized by high plasma plant sterol concentrations. PMID: 18156627
  36. The cholesterol transporters Npc1l1, Abca1, Abcg5, and Abcg8 were found to be downregulated after 2, 4, and 8 weeks on a cholesterol-free, high-fat diet. PMID: 18356535
  37. Both ABCG5 (G5) and ABCG8 (G8) have short but highly conserved cytoplasmic tails. PMID: 18402465
  38. Increased biliary cholesterol excretion in Atp8b1-deficient mice is independent of Abcg5/8 activity. PMID: 18466903
  39. LXR activation stimulated the fecal excretion of labeled cholesterol after an intravenous injection of HDL-[(3)H]cholesteryl oleate in G5/G8(+/+) mice, but failed to enhance fecal [(3)H]cholesterol in G5/G8(-/-) mice. PMID: 18509196
  40. Abcg5 (-/-) mice develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissues. PMID: 18796403
  41. In the liver, histone H3 in the proximal promoter of Abcg5 is hyperacetylated, whereas acetylation in the kidney and the cerebrum is minimal. PMID: 19047482

Show More

Hide All

Database Links
Involvement In Disease
A spontaneous mutation gives raise to thrombocytopenia and cardiomyopathy (trac), with recessive inheritance and fully penetrant phenotype. Mice are small, infertile, and have shortened lifespan.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver and jejunum. Detected on enterocyte villi (at protein level). Expressed in jejunum, ileum and, at lower level, in the liver.

Q&A

What is the basic structure of mouse Abcg5 protein?

Mouse Abcg5 is a half-transporter belonging to the ATP-binding cassette (ABC) superfamily, subfamily G. The protein consists of a single ABC cassette in the amino terminal region followed by six putative transmembrane domains. Unlike full transporters that contain two ATP-binding cassettes and two sets of transmembrane domains, Abcg5 must form dimers to become functionally active. The protein has a molecular weight of approximately 75 kDa and is predominantly expressed in the liver and intestine .

How does Abcg5 function in sterol transport?

Abcg5 functions exclusively as an obligate heterodimer with Abcg8 to regulate sterol homeostasis. This heterodimeric complex limits intestinal absorption and promotes biliary excretion of neutral sterols. When properly paired and localized to the apical membranes of enterocytes and hepatocytes, the Abcg5/Abcg8 complex utilizes ATP hydrolysis to actively transport sterols across cellular membranes. The complex specifically promotes the efflux of dietary plant sterols and cholesterol from enterocytes back into the intestinal lumen, thereby limiting their absorption. In hepatocytes, the complex facilitates the excretion of sterols into bile .

What phenotypes are associated with Abcg5 dysfunction?

Mutations causing loss of function in either Abcg5 or Abcg8 result in an identical clinical phenotype known as sitosterolemia. This rare autosomal recessive disorder is characterized by the accumulation of plant sterols (phytosterols) and shellfish sterols in blood and tissues. Patients with sitosterolemia exhibit hypercholesterolemia, premature atherosclerosis, and tendon xanthomas. In mouse models, knockout of either Abcg5 or Abcg8 leads to increased plasma phytosterol levels, decreased biliary cholesterol excretion, and altered sterol homeostasis, mirroring the human condition .

How can researchers confirm Abcg5 and Abcg8 heterodimer formation?

Researchers can confirm Abcg5/Abcg8 heterodimer formation through several complementary methods:

  • Co-immunoprecipitation (Co-IP): By expressing tagged versions of Abcg5 and Abcg8 in cell culture systems, researchers can perform Co-IP experiments where antibodies against one protein can pull down the interacting partner, demonstrating physical association.

  • Blue Native PAGE (BN-PAGE): This technique allows visualization of native protein complexes. When Abcg5 and Abcg8 are co-expressed, a distinct band corresponding to the heterodimer can be observed, which differs from the patterns seen when either protein is expressed alone .

  • Fluorescence resonance energy transfer (FRET): By tagging Abcg5 and Abcg8 with different fluorophores, researchers can detect energy transfer between the fluorophores when the proteins are in close proximity, confirming their interaction.

  • Cellular localization studies: Immunofluorescence microscopy can demonstrate that co-expression of both proteins is required for proper trafficking to the plasma membrane, whereas expression of either protein alone results in endoplasmic reticulum (ER) retention .

Can Abcg5 form functional complexes with other ABCG family members?

Experimental evidence indicates that while Abcg5 can physically interact with other ABCG family members, these interactions do not form functional complexes for sterol transport. Studies have shown that G1, G2, and G4 can co-immunoprecipitate with G5, and G4 can co-immunoprecipitate with G8, but these putative dimers are retained in the endoplasmic reticulum (ER) and do not reach the plasma membrane. Only the Abcg5/Abcg8 heterodimer efficiently exits the ER and localizes to the apical membranes where it performs its transport function. Adenoviral expression of G2 in the presence or absence of G5 or G8 failed to promote sterol excretion into bile, further confirming the specific requirement for the G5/G8 heterodimer in sterol transport .

What expression systems are most effective for producing recombinant mouse Abcg5?

Several expression systems have proven effective for producing recombinant mouse Abcg5, each with specific advantages depending on research objectives:

Expression SystemAdvantagesLimitationsBest For
Sf9 insect cellsHigh protein yield, post-translational modifications, suitable for structural studiesMay have different glycosylation patterns than mammalian cellsProtein purification, biochemical assays
Mammalian cell lines (HEK293, COS-7)Native-like post-translational modifications, trafficking studiesLower protein yield compared to insect cellsTrafficking studies, functional assays
Adenoviral expression in vivoPhysiological context, organ-specific expressionRequires animal experimentation, variable expression levelsIn vivo functional studies

When expressing Abcg5, it is critical to co-express Abcg8 to achieve proper protein folding, trafficking, and function. Studies have demonstrated that when expressed alone in any system, Abcg5 is retained in the endoplasmic reticulum and does not reach the plasma membrane .

How can researchers assess the ATP-binding and hydrolysis activity of recombinant Abcg5?

Researchers can assess the ATP-binding and hydrolysis activity of recombinant Abcg5 (always in complex with Abcg8) through several methodological approaches:

  • ADP-trapping assays: This modified method uses partially purified, detergent-solubilized recombinant G5 and G8, or inside-out vesicles (IOVs) containing G5/G8. The proteins are incubated in reaction buffer (50 mM Tris-Cl, pH 7.5, 0.1 mM EGTA, 2 mM MgCl2) containing 10 μM 8-azido-[α-32P]ATP. Following incubation, cross-linking and analysis by SDS-PAGE or autoradiography can detect the trapped nucleotide .

  • Colorimetric phosphate release assays: These assays measure inorganic phosphate released during ATP hydrolysis using colorimetric reagents like malachite green.

  • Fluorescent ATP analogs: Using ATP analogs with fluorescent properties allows for real-time monitoring of binding and hydrolysis.

  • ATP hydrolysis coupled enzyme assays: These link ATP hydrolysis to the oxidation of NADH, which can be monitored spectrophotometrically.

It's important to note that since Abcg5 functions only as a heterodimer with Abcg8, these assays should be performed with both proteins present to obtain physiologically relevant results.

What techniques are most effective for studying Abcg5 trafficking in cell models?

Several complementary techniques are particularly effective for studying Abcg5 trafficking:

  • Immunofluorescence microscopy: Using specific antibodies against Abcg5 or epitope tags engineered into the protein, researchers can visualize the subcellular localization of Abcg5 in fixed cells. Co-staining with markers for different cellular compartments (ER, Golgi, plasma membrane) helps determine the trafficking status .

  • Live-cell imaging: By generating fusion proteins with fluorescent tags (GFP, mCherry), researchers can monitor Abcg5 trafficking in real-time in living cells.

  • Cell surface biotinylation: This technique specifically labels proteins at the cell surface, allowing quantification of the proportion of Abcg5 that has successfully trafficked to the plasma membrane.

  • Glycosidase sensitivity assays: As proteins traffic through the secretory pathway, they undergo glycosylation modifications. Treatment with endoglycosidases can reveal the trafficking status of Abcg5 based on its glycosylation pattern.

  • Density gradient centrifugation: This technique separates cellular membranes based on their density, allowing for biochemical analysis of Abcg5 distribution in different cellular compartments.

Research has consistently shown that Abcg5 requires co-expression with Abcg8 to exit the ER and traffic to the plasma membrane, specifically to the apical membranes in polarized epithelial cells .

How can researchers distinguish between properly folded and misfolded Abcg5 proteins?

Distinguishing between properly folded and misfolded Abcg5 proteins is critical for functional studies. Researchers can employ these methods:

  • Endoglycosidase H (Endo H) sensitivity: Properly folded proteins that have exited the ER acquire complex glycosylation and become resistant to Endo H digestion, while misfolded proteins retained in the ER remain Endo H sensitive.

  • Protease susceptibility assays: Properly folded proteins typically have a more compact structure with fewer exposed protease cleavage sites compared to misfolded proteins.

  • Detergent solubility: Properly folded membrane proteins are often more soluble in milder detergents, while misfolded proteins may require harsher detergents for extraction.

  • Thermal stability assays: Using techniques like differential scanning fluorimetry, researchers can assess the thermal stability of proteins as an indicator of proper folding.

  • Co-chaperone interactions: Misfolded proteins often remain bound to chaperones like BiP/GRP78 or calnexin/calreticulin, which can be detected by co-immunoprecipitation.

  • Trafficking status: As a functional readout, properly folded Abcg5 (when co-expressed with Abcg8) will traffic to the plasma membrane, while misfolded proteins will be retained in the ER .

What are the most reliable methods to measure Abcg5-mediated sterol transport?

Several robust methods have been developed to measure Abcg5-mediated sterol transport:

  • Biliary cholesterol excretion in vivo: This gold-standard approach involves collecting bile from the gallbladder or through bile duct cannulation in mice expressing recombinant Abcg5/Abcg8. Sterol content is then analyzed by gas or liquid chromatography-mass spectrometry. Studies show that co-expression of Abcg5 and Abcg8 can increase biliary cholesterol concentration up to 10-fold compared to controls .

  • Radiolabeled sterol flux assays: Cells expressing Abcg5/Abcg8 are loaded with radiolabeled sterols (³H-cholesterol or ¹⁴C-plant sterols), and efflux to acceptor molecules is measured over time.

  • Fluorescent sterol analogs: Using fluorescent sterols such as NBD-cholesterol or BODIPY-cholesterol allows for real-time monitoring of sterol transport in living cells.

  • Intestinal sterol absorption: Measuring the difference between dietary sterol intake and fecal sterol excretion can assess Abcg5/Abcg8-mediated limitation of sterol absorption.

  • Mass spectrometry-based sterol quantification: This technique provides precise quantification of specific sterol species transported by Abcg5/Abcg8.

It is essential to include appropriate controls in these assays, such as ATP-binding cassette transporter mutants defective in ATP binding/hydrolysis, to confirm that observed transport is actively mediated by the Abcg5/Abcg8 complex.

How can researchers assess the impact of mutations on Abcg5 function?

Researchers can employ a multi-faceted approach to assess the impact of mutations on Abcg5 function:

  • In silico analysis: Computational methods such as molecular dynamics simulations and protein structure prediction can provide initial insights into how mutations might affect protein structure and function.

  • Expression and trafficking studies: Wild-type and mutant Abcg5 (co-expressed with Abcg8) can be compared for expression levels, stability, and trafficking to the plasma membrane using immunoblotting, immunofluorescence, and cell surface biotinylation.

  • ATP binding and hydrolysis assays: Comparing the ATP-binding and hydrolysis capabilities of wild-type and mutant proteins can reveal defects in the molecular mechanism of transport.

  • Sterol transport assays: Using the methods described in 5.1, researchers can directly compare the sterol transport activity of wild-type and mutant proteins.

  • Animal models: Generating knock-in mice expressing specific Abcg5 mutations can provide in vivo evidence of functional consequences.

  • Structural studies: Where possible, structural analysis of wild-type and mutant proteins using techniques like cryo-electron microscopy can reveal how mutations affect protein conformation.

For example, adenovirus-mediated expression of either wild-type or mutant Abcg5 in the liver of Abcg5/Abcg8 null mice has been used to demonstrate that mutations affecting the ATP-binding domain compromise biliary cholesterol secretion .

What factors regulate Abcg5 gene expression in mice?

Abcg5 gene expression is regulated by multiple factors that control sterol homeostasis:

Regulatory FactorEffect on Abcg5 ExpressionMechanism
Liver X Receptors (LXRs)UpregulationNuclear receptors activated by oxysterols bind to response elements in the Abcg5 promoter
Sterol Regulatory Element-Binding Proteins (SREBPs)Complex regulationTranscription factors responding to cellular sterol levels
Farnesoid X Receptor (FXR)UpregulationNuclear receptor activated by bile acids
DietModulationHigh-cholesterol diets typically increase expression
Hormones (e.g., thyroid hormone)ModulationAct through hormone response elements
Nuclear Factor E2-Related Factor 2 (Nrf2)UpregulationResponds to oxidative stress

Research has shown that Abcg5 expression is coordinated with Abcg8 expression, suggesting common regulatory mechanisms. Both genes are arranged in a head-to-head configuration with a shared bidirectional promoter region, which may facilitate their coordinated expression .

How does Abcg5 expression vary across different tissues in mice?

Abcg5 shows a tissue-specific expression pattern that correlates with its physiological role in sterol homeostasis:

  • Liver: High expression levels are observed in hepatocytes, where Abcg5 (with Abcg8) is localized to the canalicular (apical) membrane to promote biliary sterol excretion.

  • Small intestine: Significant expression occurs in enterocytes, with a gradient of expression along the intestinal tract (higher in proximal segments). The protein localizes to the brush border (apical) membrane to limit sterol absorption.

  • Gallbladder: Moderate expression helps maintain sterol balance in bile.

  • Brain: Lower expression levels are detected in specific regions, though its function in the brain is less well-characterized.

  • Other tissues: Minimal expression is found in kidney, lung, and other tissues.

In both liver and intestine, Abcg5 is specifically localized to the apical membranes of cells, consistent with its role in promoting sterol efflux into the bile and intestinal lumen, respectively. This localization has been confirmed through immunofluorescence microscopy in mouse tissues .

What are the challenges in crystallizing the Abcg5/Abcg8 heterodimer for structural studies?

Crystallization of the Abcg5/Abcg8 heterodimer presents several significant challenges:

  • Membrane protein nature: As integral membrane proteins, Abcg5 and Abcg8 contain hydrophobic regions that make them difficult to purify and maintain in a stable, properly folded state outside of a lipid environment.

  • Heterodimeric complex: The requirement for two different proteins to form a functional unit adds complexity to expression, purification, and crystallization. Ensuring stoichiometric expression and stable association is technically challenging.

  • Conformational flexibility: ABC transporters undergo substantial conformational changes during the transport cycle, which can lead to heterogeneity in protein preparations, complicating crystallization.

  • Post-translational modifications: Glycosylation and other modifications can introduce heterogeneity that impedes crystal formation.

  • Detergent selection: Finding detergents that efficiently extract the heterodimer from membranes while maintaining its native conformation and activity is often a process of extensive optimization.

  • Protein stability: The heterodimer may have limited stability once purified, requiring rapid crystallization trials or stabilizing strategies.

How can CRISPR/Cas9 technology be optimized for studying Abcg5 function?

CRISPR/Cas9 technology offers powerful approaches for studying Abcg5 function, with several optimization strategies:

  • Knock-in modifications: Creating precise mutations or adding tags (e.g., fluorescent proteins, epitope tags) to the endogenous Abcg5 gene allows for studying the protein at physiological expression levels.

  • Conditional knockout strategies: Using loxP sites flanking critical Abcg5 exons combined with tissue-specific Cre recombinase expression enables tissue-specific and/or inducible deletion of Abcg5.

  • Guide RNA design optimization:

    • Using algorithms to select guide RNAs with high on-target and low off-target activity

    • Targeting conserved functional domains for maximum effect

    • Employing paired nickases or high-fidelity Cas9 variants to reduce off-target effects

  • Simultaneous editing of Abcg5 and Abcg8: Given their functional interdependence, multiplexed CRISPR approaches targeting both genes can provide insights into their coordinated function.

  • Homology-directed repair templates: Designing efficient repair templates with appropriate homology arms for knock-in studies.

  • Validation strategies:

    • Deep sequencing to confirm edits and assess off-target modifications

    • Protein expression analysis to confirm knockout or proper expression of modified proteins

    • Functional assays to assess the impact of genetic modifications

  • Cell type-specific optimization: Adjusting transfection/transduction protocols for difficult-to-edit cell types such as primary hepatocytes or intestinal organoids.

When studying Abcg5, it's essential to consider its obligate partnership with Abcg8 when designing genetic modification strategies .

How does mouse Abcg5 differ from human ABCG5 in terms of structure and function?

Mouse Abcg5 and human ABCG5 share significant structural and functional similarities, but also exhibit some notable differences:

FeatureMouse Abcg5Human ABCG5Significance
Amino acid sequenceReference~80% identity with mouseHigh conservation suggests similar functions
Gene organizationChr 17, head-to-head arrangement with Abcg8Chr 2p21, head-to-head arrangement with ABCG8Conserved genomic organization
Expression patternLiver, intestine, and gallbladderLiver, intestine, and gallbladderSimilar tissue distribution
Heterodimer partnerObligate heterodimer with Abcg8Obligate heterodimer with ABCG8Conserved requirement for heterodimer formation
Substrate specificityCholesterol and plant sterolsCholesterol and plant sterolsSimilar substrate preferences
RegulationLXR, FXR responsiveLXR, FXR responsive, but some regulatory differencesSome species-specific regulation
Disease associationSitosterolemia in knockout modelsMutations cause sitosterolemia in humansSimilar pathological consequences

Despite the high degree of conservation, researchers should be cautious when extrapolating findings from mouse models to human conditions, as differences in diet, metabolism, and lipoprotein profiles between species can influence the physiological impact of Abcg5 function .

What are the key differences in sterol metabolism between wild-type mice and those with Abcg5 genetic modifications?

Genetic modification of Abcg5 in mice leads to several significant alterations in sterol metabolism:

  • Sitosterolemia: Abcg5 knockout mice exhibit dramatically increased plasma levels of plant sterols (sitosterol, campesterol) due to increased intestinal absorption and decreased biliary excretion. Wild-type mice efficiently exclude these sterols.

  • Altered biliary cholesterol secretion: Wild-type mice secrete substantial amounts of cholesterol into bile, whereas Abcg5-deficient mice show a 75-90% reduction in biliary cholesterol. This has been demonstrated through gallbladder cannulation studies.

  • Intestinal cholesterol absorption: Abcg5-deficient mice show modestly increased intestinal cholesterol absorption compared to wild-type mice.

  • Compensatory mechanisms: Abcg5-deficient mice often develop compensatory mechanisms to maintain cholesterol homeostasis, including altered cholesterol synthesis and catabolism.

  • Response to dietary challenges: When fed high-sterol diets, wild-type mice increase biliary sterol excretion, while Abcg5-deficient mice cannot mount this response and accumulate sterols.

  • Lipoprotein profile: Generally modest effects on plasma lipoprotein profiles under basal conditions, though differences become more apparent under dietary challenges.

  • Gallstone susceptibility: Wild-type mice are more susceptible to cholesterol gallstone formation than Abcg5-deficient mice when fed lithogenic diets, due to higher biliary cholesterol saturation.

Interestingly, overexpression of Abcg5/Abcg8 in transgenic mice leads to increased biliary cholesterol secretion, reduced intestinal cholesterol absorption, and protection against diet-induced hypercholesterolemia, further confirming the role of these transporters in sterol homeostasis .

How can Abcg5 research contribute to developing novel therapeutics for hypercholesterolemia?

Abcg5 research offers several promising avenues for developing novel therapeutics for hypercholesterolemia:

  • Target validation: Studies showing that overexpression of Abcg5/Abcg8 increases biliary cholesterol excretion and reduces intestinal cholesterol absorption validate these transporters as potential therapeutic targets.

  • Direct upregulation strategies: Developing compounds that increase the expression or activity of Abcg5/Abcg8 could enhance the body's natural sterol excretion pathways. This might involve:

    • LXR agonists with tissue-specific activity

    • Compounds that enhance protein stability or trafficking

    • Post-translational modifications that increase transport activity

  • Combination therapies: Targeting Abcg5/Abcg8 alongside other cholesterol-lowering mechanisms could provide synergistic effects:

    • Combining with statins (which inhibit cholesterol synthesis)

    • Pairing with PCSK9 inhibitors (which increase LDL receptor activity)

    • Using in conjunction with bile acid sequestrants

  • Biomarker development: Abcg5/Abcg8 activity or expression levels could serve as biomarkers to identify patients who might benefit from specific therapeutic approaches.

  • Gene therapy approaches: For patients with sitosterolemia due to ABCG5/ABCG8 mutations, gene therapy to restore functional transporters could be curative.

  • Diet-drug interactions: Understanding how dietary components interact with Abcg5/Abcg8 function could lead to enhanced dietary recommendations for patients on specific therapeutics.

The success of ezetimibe, which reduces intestinal cholesterol absorption partly by affecting the Niemann-Pick C1-Like 1 protein that works in the same pathway as Abcg5/Abcg8, demonstrates the therapeutic potential of targeting intestinal sterol absorption .

What experimental approaches best demonstrate the link between Abcg5 and carbohydrate metabolism?

The link between Abcg5 and carbohydrate metabolism can be investigated through several experimental approaches:

  • Congenic mouse strain studies: Research using B6.CAST-17 congenic mice has revealed that a chromosome 17 segment containing Abcg5 is associated with both increased carbohydrate intake and total energy intake. These congenic mice consumed 27% more carbohydrate and 17% more total energy compared to wild-type littermates .

  • Global gene expression analysis: Microarray studies comparing B6.CAST-17 homozygous congenic mice with wild-type B6 mice have shown differential expression of Abcg5 in the hypothalamus during carbohydrate/protein diet selection, suggesting a potential role in central regulation of carbohydrate preference .

  • Metabolic phenotyping: Comprehensive metabolic phenotyping of Abcg5-modified mice, including:

    • Glucose tolerance tests

    • Insulin sensitivity tests

    • Hyperinsulinemic-euglycemic clamps

    • Metabolic cage studies (food intake, energy expenditure)

  • Tissue-specific knockout studies: Creating tissue-specific Abcg5 knockouts (e.g., liver, intestine, hypothalamus) to dissect the contribution of Abcg5 in different tissues to carbohydrate metabolism.

  • Metabolomic profiling: Analysis of metabolites in plasma, liver, and other tissues of wild-type and Abcg5-modified mice to identify altered metabolic pathways.

  • Diet intervention studies: Challenging Abcg5-modified and control mice with different diets (high-carbohydrate, high-fat, etc.) to reveal differential metabolic responses.

  • Molecular pathway analysis: Investigating potential molecular mechanisms linking sterol metabolism to carbohydrate metabolism, such as nuclear receptor signaling (LXR, FXR) that might affect both pathways.

Research has shown that Abcg5 expression in B6.CAST-17 congenic mice was increased 1.20-fold in the hypothalamus and 1.86-fold in other tissues compared to wild-type mice, suggesting a potential link between sterol transport and carbohydrate preference or metabolism .

What are the most common pitfalls in Abcg5 expression studies and how can they be overcome?

Researchers face several common pitfalls when studying Abcg5 expression, with corresponding solutions:

  • Misinterpreting individual Abcg5 expression data

    • Pitfall: Analyzing Abcg5 expression without considering Abcg8

    • Solution: Always measure both Abcg5 and Abcg8 expression simultaneously, as they function as obligate heterodimers and their co-expression is required for proper protein trafficking and function .

  • Incorrect subcellular localization

    • Pitfall: Observing ER-retained Abcg5 and interpreting it as functional

    • Solution: Verify plasma membrane localization using surface biotinylation, confocal microscopy with membrane markers, or functional assays, as ER-retained protein is non-functional .

  • Antibody cross-reactivity

    • Pitfall: Non-specific antibody binding leading to false positives

    • Solution: Validate antibodies using Abcg5 knockout tissues as negative controls, and consider epitope-tagged constructs when studying recombinant proteins.

  • RNA-protein expression discrepancy

    • Pitfall: Assuming RNA levels directly correlate with protein levels

    • Solution: Measure both mRNA (qPCR) and protein (Western blot) levels, as post-transcriptional regulation can affect Abcg5 protein expression.

  • Unrecognized compensatory mechanisms

    • Pitfall: Missing compensatory changes in knockout models

    • Solution: Examine expression of related transporters and metabolic enzymes in Abcg5-modified models.

  • Strain-specific effects

    • Pitfall: Overgeneralizing findings from a single mouse strain

    • Solution: Validate key findings across multiple genetic backgrounds, as demonstrated by the B6.CAST-17 congenic strain studies .

  • Overlooking diet effects

    • Pitfall: Missing diet-induced changes in Abcg5 expression

    • Solution: Control dietary conditions carefully and consider testing multiple dietary conditions, as Abcg5 expression is responsive to dietary sterols.

  • Inappropriate experimental time points

    • Pitfall: Missing temporal dynamics of expression

    • Solution: Conduct time-course experiments, particularly when studying diet-induced changes or circadian variations in expression .

How can researchers effectively troubleshoot ATP-binding and transport assays for Abcg5/Abcg8?

Troubleshooting ATP-binding and transport assays for Abcg5/Abcg8 requires systematic analysis of multiple experimental components:

  • Protein quality issues

    • Problem: Inactive or partially denatured protein preparations

    • Solution:

      • Verify protein integrity by SDS-PAGE and Western blotting

      • Optimize detergent conditions to maintain native conformation

      • Include positive controls (known active ABC transporters)

      • Use freshly prepared protein samples

  • ATP-binding assay troubleshooting

    • Problem: Low or undetectable ATP binding

    • Solution:

      • Ensure proper Mg²⁺ concentration (typically 2-5 mM) in reaction buffer

      • Optimize ATP concentration (10-100 μM range)

      • Verify pH of reaction buffer (typically pH 7.4-7.5)

      • Include ATP-binding deficient mutants as negative controls

      • For ADP-trapping assays, ensure proper 8-azido-[α-³²P]ATP concentration (approximately 10 μM)

  • Transport assay issues

    • Problem: Low or variable sterol transport activity

    • Solution:

      • Ensure both Abcg5 and Abcg8 are expressed and properly localized

      • Optimize cholesterol loading conditions (concentration, time)

      • Use appropriate acceptors for efflux (HDL, apoA-I)

      • Include appropriate negative controls (ATP-binding deficient mutants)

      • For in vivo assays, standardize bile collection methods and timing

  • Reconstitution system problems

    • Problem: Poor protein incorporation into liposomes

    • Solution:

      • Optimize lipid composition (include cholesterol)

      • Try different reconstitution methods (detergent dialysis, direct incorporation)

      • Verify protein orientation in vesicles

      • Ensure vesicle integrity using calcein leakage assays

  • Signal detection issues

    • Problem: Poor signal-to-noise ratio

    • Solution:

      • Increase protein concentration

      • Optimize incubation times

      • Use more sensitive detection methods

      • Reduce background binding by including appropriate blocking agents

  • Data interpretation challenges

    • Problem: Distinguishing specific from non-specific activities

    • Solution:

      • Include ATP-binding or transport-deficient mutants as controls

      • Perform ATP-dependence studies (AMP vs. ATP)

      • Verify sterol specificity with different sterol substrates

      • Conduct competition experiments with known substrates

By systematically addressing these potential issues, researchers can develop robust assays for studying the ATP-binding and transport activities of the Abcg5/Abcg8 heterodimer .

What are the most promising future research directions for Abcg5 studies?

Several promising research directions are emerging in the field of Abcg5 studies:

  • Structural biology: Obtaining high-resolution structures of the Abcg5/Abcg8 heterodimer in different conformational states would provide unprecedented insights into the mechanism of sterol transport and guide structure-based drug design.

  • Tissue-specific roles: Using conditional knockout models to elucidate the specific roles of Abcg5/Abcg8 in different tissues, particularly exploring non-canonical functions beyond the well-established roles in intestine and liver.

  • Regulatory network mapping: Comprehensive characterization of the transcriptional, post-transcriptional, and post-translational regulatory networks controlling Abcg5/Abcg8 expression and function.

  • Metabolic crosstalk: Further investigation of the relationship between Abcg5 and carbohydrate metabolism, as suggested by the B6.CAST-17 congenic mouse studies, could reveal novel metabolic interactions .

  • Therapeutic targeting: Development of small molecules or biologics that can modulate Abcg5/Abcg8 activity for the treatment of hypercholesterolemia, sitosterolemia, or related metabolic disorders.

  • Personalized medicine approaches: Exploring how genetic variants in human ABCG5/ABCG8 affect response to dietary interventions or lipid-lowering therapies.

  • Interaction with microbiome: Investigating how intestinal microbiota influence Abcg5/Abcg8 function and vice versa, particularly in the context of sterol metabolism.

  • Novel physiological roles: Exploring potential roles of Abcg5/Abcg8 in non-canonical tissues such as the brain, where sterol homeostasis is tightly regulated but poorly understood in relation to these transporters.

  • Integration with systems biology: Applying systems biology approaches to understand how Abcg5/Abcg8 function integrates with other aspects of lipid metabolism and whole-body physiology .

How might advanced genetic tools enhance our understanding of Abcg5 function?

Advanced genetic tools offer unprecedented opportunities to deepen our understanding of Abcg5 function:

  • CRISPR base editing and prime editing: These precision techniques allow for introduction of specific point mutations without double-strand breaks, enabling creation of disease-relevant mutations or reporter tags with minimal off-target effects.

  • Single-cell transcriptomics: Applying scRNA-seq to tissues expressing Abcg5/Abcg8 can reveal cell-type specific expression patterns and responses to physiological or pharmacological interventions.

  • Spatial transcriptomics: These methods can map Abcg5/Abcg8 expression patterns within intact tissues, providing insights into expression gradients along the intestinal tract or within liver lobules.

  • Inducible expression systems: Advanced inducible systems (e.g., Tet-On/Off, optogenetics) allow temporal control of Abcg5/Abcg8 expression, enabling studies of acute versus chronic effects.

  • In vivo CRISPR screens: Pooled CRISPR screens in mice can identify genes that interact with Abcg5/Abcg8 or modify their phenotypes.

  • Humanized mouse models: Creating mice with human ABCG5/ABCG8 genes can provide better translational models for studying human-specific aspects of these transporters.

  • Organoid technologies: Intestinal and liver organoids derived from wild-type or genetically modified mice can serve as physiologically relevant ex vivo models for studying Abcg5/Abcg8 function.

  • Multi-omics integration: Combining genomics, transcriptomics, proteomics, and metabolomics data from Abcg5-modified models can provide systems-level insights into the functional impact of these transporters.

  • Proximity labeling techniques: Methods like BioID or APEX can identify proteins that physically interact with or are in close proximity to Abcg5/Abcg8 in their native cellular environment.

  • In vivo imaging: Development of probes for non-invasive imaging of sterol transport in living animals could provide dynamic views of Abcg5/Abcg8 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.