Recombinant Mouse ATP-binding cassette sub-family G member 8 (Abcg8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ABCG8

ABCG8 is a half-transporter in the ATP-binding cassette (ABC) family, functioning exclusively as a heterodimer with ABCG5 to export neutral sterols (e.g., cholesterol, plant sterols) into bile and the intestinal lumen . Mutations in either gene cause sitosterolemia, a disorder characterized by hyperabsorption of dietary sterols and xanthomas . Recombinant ABCG8 is engineered to study its trafficking, dimerization, and substrate specificity in controlled systems.

Synthesis and Production

Recombinant ABCG8 is produced via heterologous expression in various systems, with purity and applications varying by host.

Host SystemPurityKey ApplicationsSources
E. coli>95%SDS-PAGE, ELISA, immunoprecipitation
Insect cells (e.g., SF9)>95% (crystallization grade)Structural studies (e.g., cryo-EM), functional assays
Mammalian cells>85% (SDS-PAGE)Co-expression with ABCG5, trafficking studies
Yeast/Baculovirus>85%Partial protein studies (isoforms)

Purification Methods:

  • Affinity chromatography: Utilizes His-tags or epitope tags (e.g., myc, HA) .

  • Size-exclusion chromatography: Ensures monodispersity for crystallization .

  • SDS-PAGE: Validates molecular weight and purity .

Functional Roles

ProcessMechanismOutcomeSources
Sterol effluxBinds cholesterol in cytosolic leaflet; transports to extracellular spaceReduced biliary cholesterol in G5G8−/− mice
Cholesterol homeostasisLimits intestinal cholesterol absorption; promotes biliary excretionPrevents hypercholesterolemia in healthy mice
Disease modelingRecombinant ABCG8/ABCG5 complexes mimic sitosterolemia pathologyInsights into therapeutic targets

Applications in Research

Recombinant ABCG8 is instrumental in studying lipid transport and disease mechanisms.

Experimental Techniques

MethodPurposeFindingsSources
Cryo-EMResolve ABCG5-ABCG8 structure in sterol-bound statesIdentified sterol-binding pockets; NBD asymmetry
Co-immunoprecipitationConfirm heterodimer formation with ABCG5ER retention without ABCG5; Golgi-mediated glycosylation
ATPase assaysMeasure ATP hydrolysis activityABCG5 drives ATPase activity; ABCG8 inhibits it
Epitope taggingTrack protein localization (e.g., myc/HA tags)Colocalization with apical markers (e.g., aminopeptidase N)

Key Research Findings

  1. Trafficking Dependency: ABCG8 requires ABCG5 for ER-to-plasma membrane trafficking. Both proteins undergo N-linked glycosylation, which becomes Endo H-resistant only when co-expressed .

  2. Sterol-Binding Specificity: Cryo-EM structures reveal two sterol-binding sites in ABCG5-ABCG8, with higher affinity for cholesterol than plant sterols .

  3. Pathological Relevance: G5G8−/− mice exhibit reduced biliary cholesterol and sitosterolemia-like phenotypes, validating ABCG8’s role in sterol homeostasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
Abcg8; ATP-binding cassette sub-family G member 8; Sterolin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAEKTKEETQLWNGTVLQDASQGLQDSLFSSESDNSLYFTYSGQSNTLEVRDLTYQVDIA SQVPWFEQLAQFKIPWRSHSSQDSCELGIRNLSFKVRSGQMLAIIGSSGCGRASLLDVIT GRGHGGKMKSGQIWINGQPSTPQLVRKCVAHVRQHDQLLPNLTVRETLAFIAQMRLPRTF SQAQRDKRVEDVIAELRLRQCANTRVGNTYVRGVSGGERRRVSIGVQLLWNPGILILDEP TSGLDSFTAHNLVTTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQQ MVQYFTSIGHPCPRYSNPADFYVDLTSIDRRSKEREVATVEKAQSLAALFLEKVQGFDDF LWKAEAKELNTSTHTVSLTLTQDTDCGTAVELPGMIEQFSTLIRRQISNDFRDLPTLLIH GSEACLMSLIIGFLYYGHGAKQLSFMDTAALLFMIGALIPFNVILDVVSKCHSERSMLYY ELEDGLYTAGPYFFAKILGELPEHCAYVIIYAMPIYWLTNLRPVPELFLLHFLLVWLVVF CCRTMALAASAMLPTFHMSSFFCNALYNSFYLTAGFMINLDNLWIVPAWISKLSFLRWCF SGLMQIQFNGHLYTTQIGNFTFSILGDTMISAMDLNSHPLYAIYLIVIGISYGFLFLYYL SLKLIKQKSIQDW
Uniprot No.

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that facilitates Mg(2+)- and ATP-dependent sterol transport across cell membranes. This heterodimer plays a crucial role in the selective transport of dietary cholesterol into and out of enterocytes and in the selective sterol excretion by the liver into bile. It is essential for preventing the accumulation of dietary plant sterols in the body. The ABCG5/ABCG8 heterodimer is required for normal sterol homeostasis and exhibits ATPase activity.
Gene References Into Functions
  1. Alternatively spliced forms of Abcg8 have been identified, resulting from a CAG repeat at the intron 1 splice-acceptor site, leading to the deletion of a glutamine. PMID: 11907139
  2. While Abcg8 is essential for most diosgenin-induced biliary cholesterol hypersecretion, diosgenin likely does not directly interact with Abcg5/Abcg8, but rather increases cholesterol delivery to the heterodimer. PMID: 15619238
  3. Aging significantly enhances cholesterol absorption by suppressing the expression of the jejunal and ileal sterol efflux transporter Abcg8. PMID: 16179600
  4. Distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis have been observed in abcg8 transgenic mice. PMID: 17060690
  5. Deletion of the Abcg8 gene alone significantly increases the mass of intestinal cholesterol and sitostanol absorption and reduces, but does not eliminate, hepatic secretion of cholesterol. PMID: 17393508
  6. ABCG8 deficient mice develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissues. PMID: 18796403

Show More

Hide All

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver and jejunum (at protein level). Expressed in jejunum and ileum and, at lower level, in the liver.

Q&A

What is the molecular function of mouse ABCG8 and how does it relate to cholesterol metabolism?

Mouse ABCG8 is an ATP-binding cassette transporter that functions as a heterodimer with ABCG5 to regulate sterol transport, particularly in the liver and intestine. The ABCG5-ABCG8 (G5G8) heterodimer mediates the secretion of neutral sterols into bile and the gut lumen, playing a critical role in maintaining cellular cholesterol homeostasis. The transport mechanism involves an accessible sterol-binding site from the cytosolic leaflet, with a second binding site located midway through the transmembrane domains . This heterodimeric complex requires ATP binding and hydrolysis to facilitate the active transport of cholesterol and other sterols across cellular membranes, helping to prevent sterol accumulation and maintain appropriate cholesterol levels .

How does the structure of mouse ABCG8 contribute to its functional capabilities?

The mouse ABCG8 protein has a calculated molecular weight of approximately 34.0 kDa and contains specific structural domains that enable its transport function . Based on human ABCG structural studies, the protein contains transmembrane domains that form the sterol-binding site and a nucleotide-binding domain (NBD) that interacts with ATP . The Walker A motif in ABCG8 adopts a unique conformation that contributes to the asymmetry in ATPase activities between the two nucleotide-binding sites of the G5G8 heterodimer . This structural arrangement is critical for the directional transport of sterols. The protein's three-dimensional conformation creates a pathway that allows cholesterol molecules to move from the cytosolic leaflet of the membrane to the extracellular space or lumen .

What genomic and proteomic characteristics define mouse Abcg8?

Mouse Abcg8 is located on Chromosome 17 and is referenced in genomic databases as NC_000083.7 in the GRCm39 C57BL/6J reference genome . The translated protein has several aliases including GBD4, STSL, and STSL1 . The recombinant form of the protein typically includes the amino acid sequence from Met1 to Gln272, often with an N-terminal His tag to facilitate purification and detection in experimental settings . Mouse ABCG8 shares significant homology with human ABCG8, making it a valuable model protein for studying cholesterol transport mechanisms relevant to human health and disease .

What are the optimal expression systems for producing recombinant mouse ABCG8?

For recombinant mouse ABCG8 production, prokaryotic expression systems using E. coli have been successfully employed . This approach typically yields protein with high purity (>95%) suitable for various experimental applications. The expression construct should contain the coding sequence for mouse ABCG8 (Met1-Gln272) with an N-terminal His tag to facilitate purification . When designing expression systems, researchers should consider that the full-length membrane protein may be challenging to express in prokaryotic systems due to its transmembrane domains. Therefore, expressing specific fragments or domains may be more practical for certain applications . Alternative expression systems such as insect cells or mammalian cells may be more appropriate when studying the complete heterodimeric complex with ABCG5, as these systems better support proper protein folding and post-translational modifications of complex membrane proteins .

What are the recommended purification and storage protocols for recombinant mouse ABCG8?

Purification of recombinant mouse ABCG8 typically involves affinity chromatography utilizing the N-terminal His tag . The purified protein is generally lyophilized for long-term stability and can be reconstituted to concentrations between 0.1-1.0 mg/ml. For reconstitution, it is recommended to use ddH₂O to maintain the original salt concentration or PBS (pH 7.4) if a different concentration is required .

For storage, the following conditions are recommended:

  • Short-term (up to one month): 2-8°C

  • Long-term (up to one year): -80°C

  • Avoid repeated freeze/thaw cycles that can compromise protein integrity

The reconstitution process should be gentle, avoiding vortexing which can denature the protein. For working solutions, the protein can be buffered in PBS (pH 7.4) containing minimal amounts of detergent (0.01% Sarcosyl), reducing agent (1 mM DTT), cryoprotectant (5% Trehalose), and preservative (Proclin-300) .

How can researchers effectively validate the functionality of recombinant mouse ABCG8?

Validating recombinant mouse ABCG8 functionality requires multiple approaches:

  • Structural integrity assessment: Western blotting and SDS-PAGE can confirm the molecular weight (calculated 34.0 kDa) and purity of the recombinant protein .

  • Cholesterol binding assays: Given ABCG8's role in sterol transport, binding assays using radiolabeled or fluorescently labeled cholesterol can assess the protein's ability to interact with its natural substrate .

  • ATPase activity measurement: Since ABCG8 functions as an ATP-dependent transporter, measuring ATP hydrolysis rates in the presence and absence of sterols can confirm functionality .

  • Heterodimer formation: For complete functional studies, researchers should assess ABCG8's ability to form heterodimers with ABCG5, as this complex represents the physiologically relevant transporter .

  • Sterol efflux assays: Using cell-based systems expressing recombinant ABCG8 (with ABCG5), measure the efflux of cholesterol or plant sterols to appropriate acceptors to validate transport activity .

What are the known functional variants of mouse Abcg8 and their phenotypic effects?

While the search results primarily focus on human variants, the mouse model serves as an important comparative system for understanding ABCG8 function. Genetic manipulation studies in mice have confirmed that ABCG8, in conjunction with ABCG5, transports cholesterol . Mouse models with Abcg8 mutations typically exhibit:

  • Increased plant sterol absorption and accumulation

  • Altered cholesterol homeostasis

  • Disrupted biliary cholesterol secretion

These phenotypes mirror aspects of human sitosterolemia, a rare autosomal recessive disorder caused by mutations in either ABCG5 or ABCG8 . The translational value of mouse Abcg8 research is supported by the significant homology between mouse and human proteins and the conservation of critical functional domains .

How do human ABCG8 variants inform research on mouse models?

Human studies have identified multiple variants in ABCG8 with varying pathogenicity . These findings provide valuable guidance for mouse model development:

Variant TypeNumber IdentifiedMedian Sitosterol LevelClassification
Putative Pathogenic6 ABCG8 variants10.1 [6.5-17.1] μg/mLHeterozygous: ≥5 μg/mL; Homozygous: ≥10 μg/mL
Benign6 ABCG8 variants3.5 [2.5-4.1] μg/mLBelow pathogenic thresholds

The most common pathogenic variant identified in humans is c.1256T>A (p.Ile419Asn) in ABCG8 . Researchers working with mouse models can target homologous regions to create relevant disease models. The functional characterization of these variants in humans—particularly regarding their effects on sitosterol levels—provides benchmarks for evaluating similar mutations introduced into mouse models .

What are the challenges in translating mouse Abcg8 research to human applications?

Despite the utility of mouse models, several challenges exist when translating findings to human applications:

  • Species-specific differences in cholesterol metabolism: Mice naturally have different lipoprotein profiles and cholesterol handling mechanisms compared to humans .

  • Genetic background effects: The phenotypic expression of Abcg8 variants can be influenced by the genetic background of mouse strains, potentially confounding interpretations .

  • Heterodimer complexity: The ABCG5-ABCG8 heterodimer exhibits complex regulatory mechanisms with asymmetric ATPase activities, making it challenging to isolate ABCG8-specific effects .

  • Variant interpretation: Not all variants have equivalent effects across species. A pathogenic variant in humans may not produce identical phenotypes in mice, necessitating careful validation of mouse models .

Researchers must consider these factors when designing experiments and interpreting results from mouse models for application to human cholesterol transport disorders .

How can structural insights into ABCG8 inform drug development targeting cholesterol transport?

The cryo-EM structures of human G5G8 in sterol-bound states and G1 in cholesterol- and ATP-bound states provide critical insights for drug development . Specifically:

  • Binding site targeting: The identified sterol-binding site accessible from the cytosolic leaflet represents a potential target for small molecule modulators of ABCG8 function .

  • ATP binding modulation: The unique conformation of the Walker A motif in ABCG8 contributes to asymmetric ATPase activities, suggesting opportunities for selective modulation of ATP binding or hydrolysis .

  • Heterodimer interface: The interface between ABCG5 and ABCG8 could be targeted to either enhance or inhibit heterodimer formation, thereby affecting cholesterol transport .

  • Conformational changes: Understanding the protein's conformational changes during the transport cycle enables the design of compounds that could lock the transporter in specific states .

Mouse ABCG8 serves as an excellent model system for preliminary testing of such drug development approaches due to its similarity to human ABCG8 .

What are the most effective in vivo models for studying Abcg8 function in cholesterol homeostasis?

Several in vivo models have proven valuable for studying Abcg8 function:

These models enable researchers to investigate both basic mechanisms of cholesterol transport and potential therapeutic approaches for disorders of cholesterol homeostasis .

How can recombinant mouse ABCG8 be used to investigate potential interactions with other transporters or regulatory proteins?

Recombinant mouse ABCG8 provides a valuable tool for investigating protein-protein interactions important in cholesterol homeostasis:

  • Co-immunoprecipitation studies: Using tagged recombinant ABCG8 (such as His-tagged variants) to pull down potential interacting partners from cellular lysates .

  • Proximity labeling approaches: Fusion of ABCG8 with enzymes like BioID or APEX2 can identify proteins in close proximity to ABCG8 in living cells.

  • Reconstitution systems: Incorporating purified recombinant ABCG8 with ABCG5 and other potential interacting proteins into liposomes or nanodiscs to study functional interactions in a controlled environment .

  • Competitive binding assays: Using recombinant ABCG8 to identify molecules that compete with cholesterol for binding, potentially revealing endogenous regulators of transport activity .

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry analysis can identify interaction interfaces between ABCG8 and other proteins.

These approaches can reveal how ABCG8 functions within the broader network of proteins involved in cholesterol homeostasis, potentially identifying new therapeutic targets .

What are common challenges in working with recombinant mouse ABCG8 and how can they be addressed?

Researchers working with recombinant mouse ABCG8 frequently encounter several challenges:

  • Protein stability issues: As a membrane protein, ABCG8 can be unstable outside its native environment. Using appropriate detergents (such as 0.01% Sarcosyl) and reducing agents (1 mM DTT) in buffers can enhance stability . Additionally, including stabilizing agents like trehalose (5%) during lyophilization helps maintain protein integrity .

  • Solubility challenges: To improve solubility, reconstitute lyophilized protein gradually and avoid vortexing, which can cause aggregation . Maintaining protein concentration between 0.1-1.0 mg/ml typically provides optimal solubility .

  • Functional assessment limitations: Since ABCG8 naturally functions as a heterodimer with ABCG5, assessing the activity of ABCG8 alone may not reflect its physiological function . When possible, co-express or co-reconstitute with ABCG5 for functional studies.

  • Expression yield variability: Prokaryotic expression systems may yield variable amounts of functional protein . Optimizing codon usage for E. coli and employing specialized strains designed for membrane protein expression can improve yields.

  • Conformation authenticity: Ensuring the recombinant protein adopts a native-like conformation is critical. Circular dichroism spectroscopy can be used to assess secondary structure content and compare it to theoretical predictions.

How can researchers distinguish between effects specific to ABCG8 versus those related to the ABCG5-ABCG8 heterodimer?

Distinguishing ABCG8-specific effects from heterodimer effects requires careful experimental design:

  • Parallel expression systems: Express ABCG8 alone, ABCG5 alone, and the ABCG5-ABCG8 heterodimer under identical conditions to compare properties directly.

  • Domain-specific mutations: Introduce mutations in ABCG8 that specifically affect its function without disrupting heterodimer formation to identify ABCG8-specific contributions.

  • Chimeric proteins: Create chimeric proteins between ABCG8 and other ABCG family members to map functional domains specific to ABCG8.

  • Competitive inhibition: Use ABCG8-specific antibodies or peptides that bind to regions not involved in heterodimer formation to selectively inhibit ABCG8 functions within the heterodimer complex.

  • Asymmetric ATP binding/hydrolysis: Exploit the asymmetric ATPase activities between ABCG5 and ABCG8 nucleotide-binding domains to selectively target ABCG8 function within the heterodimer .

What controls are essential when studying recombinant mouse ABCG8 in experimental settings?

Robust experimental design for studies involving recombinant mouse ABCG8 should include several key controls:

  • Negative controls:

    • Inactive ABCG8 mutant (e.g., Walker A motif mutation that abolishes ATP binding)

    • Empty vector or irrelevant protein expressed under identical conditions

    • Experiments conducted in the absence of ATP for ATP-dependent functions

  • Positive controls:

    • Known functional variants with well-characterized activity levels

    • Commercially validated ABCG8 protein with established functionality metrics

    • Co-expressed ABCG5-ABCG8 heterodimer with documented activity

  • Specificity controls:

    • Competitive inhibition with excess unlabeled substrate

    • Parallel experiments with related ABC transporters to establish selectivity

    • Dose-response relationships to establish specificity of observed effects

  • Technical validation:

    • Confirmation of protein purity via SDS-PAGE

    • Verification of molecular weight (calculated 34.0 kDa)

    • Western blot confirmation of identity using specific antibodies

  • Biological relevance controls:

    • Comparison of in vitro findings with cellular or in vivo models

    • Correlation of experimental conditions with physiological parameters

    • Validation across multiple experimental systems

Implementing these controls ensures robust, reproducible results that can be confidently interpreted and applied to understand ABCG8 biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.