Recombinant Mouse ATP-dependent zinc metalloprotease YME1L1 (Yme1l1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse ATP-dependent Zinc Metalloprotease YME1L1 (Yme1l1) is an ATP-dependent metalloprotease that belongs to the AAA family of ATPases and is encoded by the nuclear genome . Embedded in the inner mitochondrial membrane, its protease domain faces the intermembrane space . YME1L1 plays a crucial role in maintaining mitochondrial function and morphology . It was initially identified in yeast through a screen for gene products that elevate the rate of mitochondrial DNA migration to the nucleus .

Structure and Function

YME1L1 is a nuclear-encoded protein that is imported into the mitochondria as a premature form of approximately 80 kDa . Upon entry, it undergoes proteolytic processing by the mitochondrial processing peptidase (MPP), which cleaves off the mitochondrial targeting sequence (MTS) to produce a mature protein of roughly 63 kDa . This mature form then assembles into a homo-oligomeric complex within the inner mitochondrial membrane .

YME1L1 has several key functions :

  • Regulation of mitochondrial morphology and function through cleavage of OPA1 (optic atrophy 1) at position S2, which promotes the maintenance of normal mitochondrial structure and mitochondrial protein metabolism .

  • Ensuring cell proliferation .

  • Maintaining normal cristae morphology and complex I respiration activity .

  • Promoting antiapoptotic activity and protecting mitochondria from the accumulation of oxidatively damaged membrane proteins .

  • Controlling the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4, and ND1) .

  • Constitutive degradation of PRELID1 .

  • Catalyzing the degradation of OMA1 in response to membrane depolarization .

YME1L1 in Disease

Mutations in the YME1L1 gene can cause mitochondriopathies, which often manifest as multisystemic disorders affecting high-energy-consuming organs . A homozygous mutation in YME1L1 has been identified as the cause of a novel mitochondriopathy with infantile-onset developmental delay, muscle weakness, ataxia, and optic nerve atrophy .

YME1L1 and Mitochondrial Dynamics

YME1L1 is essential for regulating mitochondrial fission, function, and apoptosis . Knock-down of YME1L1 disrupts the balance of mitochondrial fusion and fission, leading to increased mitochondrial fission . This disruption can result in reduced ATP content and increased mitophagy, ultimately impairing embryo development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Yme1l1; ATP-dependent zinc metalloprotease YME1L1; ATP-dependent metalloprotease FtsH1; YME1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Yme1l1
Target Protein Sequence
MFSLSSTVQPQVTIPLSHLINAFHSPKNISVSVNTPVSQKQHRDTVPEHEAPSSEPVLNL RDLGLSELKIGQIDKMVENLLPGFYKDKRVSSCWHTSHISAQSFFENKYGHLDMFSTLRS SSLYRQHPKTLRSICSDLQYFPVFIQSRGFKTLKSRTRRLQSTSERLVEAQNIAPSFVKG FLLRDRGTDLESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILF VLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFL KNPQKFTVLGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGAS RIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVII IGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDKSVDPEIIARGT VGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAY HESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMGGR VAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIE QEIRILLRESYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR
Uniprot No.

Target Background

Function
Recombinant Mouse ATP-dependent zinc metalloprotease YME1L1 (Yme1l1) is an ATP-dependent metalloprotease that catalyzes the degradation of both folded and unfolded proteins possessing an appropriate degron sequence within the mitochondrial intermembrane region. It plays a critical role in regulating mitochondrial morphology and function by cleaving OPA1 at position S2, generating an OPA1 form that supports the maintenance of normal mitochondrial structure. YME1L1 is essential for cell proliferation, preservation of normal cristae morphology and complex I respiration activity, promotion of anti-apoptotic activity, and protection of mitochondria from the accumulation of oxidatively damaged membrane proteins. It is required for the normal, constitutive degradation of PRELID1 and catalyzes the degradation of OMA1 in response to membrane depolarization. Furthermore, YME1L1 is necessary for controlling the accumulation of unassembled respiratory chain subunits (NDUFB6, OX4, and ND1).
Gene References Into Functions
  1. Studies in a mouse model of neonatal hypoxic-ischemic brain injury indicate alterations in the expression of mitochondrial shaping proteins, such as OPA1 and Yme1L; both in vitro and in vivo, OPA1 is cleaved into shorter forms, and Yme1L expression is reduced. PMID: 26393574
  2. Constitutive OPA1 cleavage by YME1L and OMA1 at two distinct sites results in the accumulation of both long and short OPA1 forms, maintaining mitochondrial fusion. PMID: 24616225
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane. Mitochondrion.
Tissue Specificity
Detected in heart and skeletal muscle (at protein level).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.