Recombinant Mouse ATP-sensitive inward rectifier potassium channel 11 (Kcnj11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse ATP-Sensitive Inward Rectifier Potassium Channel 11 (Kcnj11)

Recombinant Mouse ATP-sensitive inward rectifier potassium channel 11 (Kcnj11) is a protein expressed in E. coli that functions as an ATP-sensitive inward rectifier potassium channel . Kcnj11 is also known as Inward rectifier K(+) channel Kir6.2 or Potassium channel, inwardly rectifying subfamily J member 11 .

Table 1: Properties of Recombinant Mouse Kcnj11 Protein

CategoryProperty
Catalog NumberRFL25622MF
SpeciesMus musculus
SourceE. coli
TagHis
Protein LengthFull Length (1-390 amino acids)
FormLyophilized powder
Amino Acid SequenceMLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALT LASSRGPLRKRSVAVAKAKPKFSISPDSLS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL

Research Findings

  1. Association with Type 2 Diabetes (T2D): Meta-analysis suggests an association between KCNJ11 polymorphism (rs5219) and the risk of T2D in East Asian and global populations . A meta-analysis of 40 case-control studies found an association of KCNJ11 rs5219 with type 2 diabetes .

  2. Impact on Cognitive Function: KCNJ11 gene mutations are the most common cause of permanent neonatal diabetes, and individuals with these mutations may exhibit lower IQ scores and reduced attention spans .

  3. Role in Epilepsy: Studies suggest a potential role for KCNJ11 in epilepsy, with research focusing on the development of antiseizure drugs that may interact with KCNJ11-related pathways .

  4. Antineoplastic Target: Potassium ion channels, including KCNJ11, have been identified as potential targets in cancer biology, suggesting that KCNJ11 may play a role in antineoplastic approaches for diseases such as breast cancer .

Table 2: Meta-Analysis of KCNJ11 Polymorphism (rs5219) Association with T2D

Population GroupOdds Ratio (OR)95% Confidence Interval (CI)
South Asian0.980.83–1.16
Indian Subgroup1.040.95–1.15
Pooled Data1.121.10–1.15

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Kcnj11; ATP-sensitive inward rectifier potassium channel 11; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj11
Target Protein Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALT LASSRGPLRKRSVAVAKAKPKFSISPDSLS
Uniprot No.

Target Background

Function
This G protein-coupled receptor is an inward rectifier potassium channel, exhibiting a higher potassium influx than efflux. Its voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening to more positive voltages. Inward rectification primarily results from internal magnesium blocking outward current. Extracellular barium can block the channel. This channel can form cardiac and smooth muscle-type KATP channels with ABCC9, where KCNJ11 forms the channel pore and ABCC9 is crucial for activation and regulation.
Gene References Into Functions
  1. Lack of Kir6.2 promoted neuronal differentiation by inhibiting the downregulation of glial cell line-derived neurotrophic factor (GDNF), inversely correlating with microRNA-133b levels. PMID: 29564810
  2. Reduced age-dependent weight gain in WNK1 transgenic mice appears linked to decreased Kir6.2 expression through WNK1- and WNK4-regulated Kir6.2 protein stability. PMID: 29392534
  3. Both Kir6.1(V65M) and Kir6.2(V64M) mutations virtually eliminate high-affinity sensitivity to the KATP blocker glibenclamide in intact cells and excised patches. This suggests that sulfonylurea therapy may be ineffective for some congenital hyperinsulinism mutations, emphasizing the need for comprehensive pharmacogenomic analyses. PMID: 28842488
  4. Increased Kir6.2 is observed in reactive astrocytes in aged 3xTg-Alzheimer's disease (AD) mice and human AD tissue. PMID: 27586053
  5. ATP-sensitive K+ Kir6.2 channels may play a novel role in regulating myocardial energy metabolism. PMID: 28667052
  6. Cardiac ischemia reduces sarcolemmal KATP channel density via dynamin-dependent endocytosis and CaMKII-mediated signaling. Ischemic preconditioning counteracts this loss and restores channel density. PMID: 27037371
  7. Lack of kcnj11 expression increases peroxynitrite-mediated modification of sarco/endoplasmic reticulum Ca2+-ATPase after myocardial ischemia-reperfusion injury, contributing to impaired diastolic function. PMID: 28209764
  8. KATP channels appear essential for murine myometrial motility via SUR2B and Kir6.2 activation. PMID: 27086859
  9. A conserved residue cluster governs the kinetics of ATP-dependent gating of Kir6.2 potassium channels. PMID: 25934393
  10. ATP-sensitive potassium currents are observed from channels formed by Kir6 and a modified cardiac mitochondrial SUR2 variant. PMID: 24037327
  11. The Kir6.2-containing K-ATP channel is necessary for resveratrol's cardioprotective effects. PMID: 24498880
  12. Mechanical dyssynchrony is reported as an early marker of cardiomyopathic disease in ATP-sensitive K channel-deficient dilated cardiomyopathy. PMID: 24308936
  13. KATP channel-dependent neuronal excitability in catecholaminergic neurons maintains thermogenic brown adipose tissue sympathetic tone and energy homeostasis. PMID: 24011078
  14. BetaIV-Spectrin-targeted CaMKII directly phosphorylates the inwardly-rectifying potassium channel, Kir6.2. PMID: 24101510
  15. Kir6.2 subunits are critical for resistance to endotoxemia-induced cardiac dysfunction by reducing myocardial damage through apoptosis and inflammation inhibition. PMID: 23659427
  16. Unrecognized slide helix elements are required for functional channel expression and control of Kir6.2 gating by intracellular ATP. PMID: 23798684
  17. Hearts from Kir6.2-/- mice exhibit a normal baseline response to ischemia-reperfusion injury and lack ischemic preconditioning protection. PMID: 23585131
  18. Data from Kir6.2 knockout mice suggest a KATP channel-independent mechanism, mediated by the vagus nerve, plays a critical role in pancreatic beta-cell insulin secretion in response to dietary carbohydrate intake. PMID: 23608222
  19. CaMKII phosphorylation of Kir6.2 promotes endocytosis of cardiac ATP-sensitive potassium channels. PMID: 23223335
  20. The Kir6.2-V59M mutation decreases ATP block of cardiac KATP channels but doesn't affect heart function, suggesting that metabolic changes do not sufficiently open the mutated channel to impact function (at least without ischemia). PMID: 22252471
  21. The Kir6.2/SUR2B complex is inhibited by protein kinase C in a Ca2+-dependent manner, likely due to internalization. PMID: 22207763
  22. Unique properties of the ATP-sensitive potassium channel in the mouse ventricular cardiac conduction system are reported. PMID: 21984445
  23. Kir6.2-containing KATP channels are important for maintaining myocardial oxygenation balance under acute stress and during post-stress recovery. PMID: 20202704
  24. The cGMP/PKG/ROS/calmodulin/CaMKII signaling pathway regulates cardiomyocyte excitability by opening KATP channels and contributes to cardioprotection against ischemia-reperfusion injury. PMID: 21479273
  25. Homozygous adult Kcnj11 (Y12STOP) mice exhibited impaired glucose tolerance and a defect in insulin secretion, both in vivo and in vitro. PMID: 20694718
  26. Ankyrin-B regulates Kir6.2 membrane expression and function in the heart. PMID: 20610380
  27. Kir6.2 sequestration in the rough endoplasmic reticulum (RER) of SUR1-/- islet cells is associated with increased RER length and mild oxidative stress without classical ER stress response activation. PMID: 20383647
  28. Glycine at position 156 is not essential for KATP channel gating; the Kir6.2 gating defect caused by the G156R mutation can be rescued by manipulating chemical interactions between pore residues. PMID: 20032456
  29. Kir6.2 potassium channels regulate muscle energy economy; their tissue-specific downregulation may offer an anti-obesity strategy by increasing muscle thermogenesis at rest and reducing fuel efficiency during exercise. PMID: 20074528
  30. The SUR1 TMD0-Kir6.2 interface is mobile; Kir6.2 gating modes correlate with distinct TMD0 positions. PMID: 19933268
  31. Kir6.2 channels significantly modulate ischemia/reperfusion injury in mice. PMID: 11854323
  32. H+ interacts with ATP in regulating a cloned KATP channel (Kir6.2 expressed with and without the SUR1 subunit). PMID: 12205184
  33. Kir6.2 maintains homeostasis and facilitates adaptation to stress. PMID: 12271142
  34. Ba2+ was used to locate the ligand-sensitive gate in Kir6.2. Internal Ba2+ accessed its binding site even when the channel was closed, indicating the gate lies within or above the selectivity filter. PMID: 12524524
  35. Intact KATP channels are integral to ischemic preconditioning-induced protection of cellular energy dynamics and cardiac performance. PMID: 12598229
  36. Four mutations associated with congenital hyperinsulinism disrupt KATP channel activity through different mechanisms. PMID: 12627323
  37. Two amino acids in Kir6.2 appear to directly interact with ATP and may contribute to the ATP binding site. PMID: 12805206
  38. Using Kir6.2 tandem dimer constructs, evidence suggests that an ion pair forms from residues in two adjacent Kir6.2 subunits, contributing to a structural framework. PMID: 12885877
  39. Transgenic Kir6.2 overexpression in the forebrain significantly protects mice from hypoxic-ischemic injury and neuronal damage in stroke. PMID: 15080888
  40. GIP is the major insulinotropic factor in insulin secretion in response to glucose load in KATP channel-deficient mice. PMID: 15362972
  41. Arcuate nucleus neurons sense glucose concentrations above 5 mmol/L through a novel KATP channel-independent mechanism. PMID: 15504956
  42. Deficits in repolarization reserve, observed in Kir6.2-knockout hearts, increase the risk of triggered activity and ventricular dysrhythmia. PMID: 15561906
  43. Kir6.2-containing KATP channel activity is required for the physiological benefits of exercise training without injury (as seen in knockout mice). PMID: 15561907
  44. Kir6.2 null and Kir6.1 null mice demonstrate that KATP channels are critical metabolic sensors in acute metabolic changes, including hyperglycemia, hypoglycemia, ischemia, and hypoxia (review). PMID: 15561908
  45. Although Kir6.2 is expressed in multiple tissues, its primary functional consequence in transgenic and knockout mice is enhanced beta-cell electrical activity. PMID: 15561946
  46. In knockout mice hearts, KATP channel activation contributes to action potential duration shortening, but is not the primary cause of extracellular K+ accumulation during early myocardial ischemia. PMID: 15598870
  47. Homology modeling and ligand docking were used to construct a Kir6.2 tetramer model and identify the ATP-binding site, located at the interface between two subunits. PMID: 15650751
  48. Conformational dynamics of the Kir6.2 ligand-binding domain are described. PMID: 15749783
  49. Epoxyeicosatrienoic acid-Kir6.2 interaction may allosterically alter the ATP binding site on Kir6.2, reducing ATP channel sensitivity. PMID: 15760904
  50. Glucose-sensing cells in the pancreas and hypothalamus utilize a similar set of stimulus-response elements. PMID: 15782099
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ11 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of KCNJ11 in mouse models?

KCNJ11 encodes the Kir6.2 subunit of ATP-sensitive potassium channels (KATP), which play a crucial role in glucose-mediated metabolic signaling pathways. In mouse models, KCNJ11 forms the channel pore while ABCC9 (SUR1) is required for activation and regulation . These channels have a greater tendency to allow potassium to flow into cells rather than out of them, with voltage dependence regulated by extracellular potassium concentration .

In pancreatic β-cells, KCNJ11-encoded channels are essential for insulin secretion regulation. Studies in Kir6.2 knockout mice have demonstrated that both glucose- and tolbutamide-induced insulin secretion, membrane depolarization, and calcium influx into β-cells are defective, confirming that insulin secretion regulation depends on KATP channel activity .

How does mouse KCNJ11 compare structurally to human KCNJ11?

Mouse and human KCNJ11 share high sequence homology and functional conservation. Both encode the Kir6.2 subunit that forms the pore of ATP-sensitive potassium channels. The core functional domains are well-preserved across species, including:

  • The transmembrane domains forming the channel pore

  • ATP-binding sites that mediate channel inhibition

  • Interaction sites with sulfonylurea receptor (SUR) proteins

What are the recommended expression systems for recombinant mouse KCNJ11?

For functional studies of recombinant mouse KCNJ11, several expression systems have proven effective, each with distinct advantages depending on research objectives:

Mammalian cell lines: HEK293 and COS-7 cells are commonly used for electrophysiological studies and protein interaction analyses. For functional expression, co-transfection with ABCC8 (SUR1) is typically necessary, as demonstrated in previous research protocols . Plasmid constructs containing mouse KCNJ11 cDNA subcloned into expression vectors like pCMV yield reliable expression.

Methodology note: When generating expression constructs, site-directed mutagenesis using single-stranded templates of pCMV KCNJ11 prepared with helper phage R408 has proven effective for creating both wild-type and mutant channels .

What are the best electrophysiological approaches for characterizing recombinant mouse KCNJ11 channels?

For comprehensive functional characterization of recombinant mouse KCNJ11 channels, the following electrophysiological approaches are recommended:

Patch-clamp techniques: Whole-cell patch-clamp recording remains the gold standard for assessing channel function. For KATP channels, inside-out patch configuration is particularly valuable as it allows direct manipulation of the intracellular environment to test ATP sensitivity.

Experimental parameters to measure:

  • ATP sensitivity (IC50 values)

  • Single-channel conductance

  • Open probability

  • Rectification properties

  • Response to pharmacological modulators

Key methodological considerations:

  • Co-expression with SUR1 is essential for proper channel function

  • Standardized pipette and bath solutions should contain (in mM): 140 KCl, 10 HEPES, 1 EGTA (pH 7.3) for pipette; and 140 KCl, 10 HEPES, 1 MgCl2, 1 CaCl2 (pH 7.3) for bath

  • ATP titration experiments should use concentrations ranging from 0.001 to 10 mM

  • All recordings should be performed at room temperature (22-24°C)

How can I assess the effects of KCNJ11 mutations on channel function?

To systematically evaluate how mutations affect mouse KCNJ11 channel function, implement the following comprehensive approach:

Step 1: Create mutant constructs
Generate mutant KCNJ11 constructs using site-directed mutagenesis. For example, studies have created mutations corresponding to human variants like R27H, R192H, and S116F117del .

Step 2: Functional characterization
Perform electrophysiological recordings to assess:

  • ATP sensitivity (shifts in dose-response curves)

  • Channel gating kinetics

  • Trafficking to cell membrane

Step 3: Molecular modeling
Complement experimental data with molecular modeling to understand structural implications. Previous research has shown that mutations like R192H can significantly affect the ATP-binding pocket, explaining observed decreases in ATP sensitivity .

Results interpretation framework:
The functional impact of mutations can be classified into categories based on experimental outcomes:

  • Loss-of-function mutations: No detectable channel currents (e.g., S116F117del)

  • Reduced ATP sensitivity: Detectable currents with altered ATP dose-response (e.g., R27H, R192H)

  • Trafficking defects: Reduced surface expression despite normal channel properties

  • Altered pharmacological responses: Changed sensitivity to sulfonylureas or other modulators

How can mouse KCNJ11 be used to model diabetes-related polymorphisms?

Mouse KCNJ11 models offer valuable platforms for investigating the functional consequences of diabetes-associated polymorphisms. A systematic research approach includes:

Generation of knock-in mouse models:
Create knock-in mice expressing KCNJ11 variants corresponding to human polymorphisms (e.g., E23K) using CRISPR-Cas9 genome editing. This allows assessment of variant effects in a physiologically relevant context.

Phenotypic characterization:

  • Glucose homeostasis: Perform glucose tolerance tests, insulin tolerance tests, and measure fasting blood glucose levels

  • Insulin secretion: Isolate pancreatic islets for ex vivo glucose-stimulated insulin secretion assays

  • Electrophysiological assessment: Compare KATP channel activity in islet β-cells from wild-type and knock-in mice

Molecular and cellular analyses:

  • Examine β-cell mass and morphology

  • Assess β-cell apoptosis rates (elevated apoptosis has been observed in Kir6.2G132S transgenic mice before hyperglycemia onset)

  • Evaluate calcium signaling in response to glucose

Data interpretation framework:
Integrate findings across multiple scales (molecular, cellular, physiological) to establish causal relationships between KCNJ11 variants and diabetic phenotypes.

What are the current challenges in studying KCNJ11 polymorphisms across different ethnic backgrounds?

Research on KCNJ11 polymorphisms has revealed significant heterogeneity in their association with type 2 diabetes across ethnic populations, presenting several methodological challenges:

Heterogeneity in genetic associations:
Meta-analyses have demonstrated that while the E23K polymorphism (rs5219) shows significant association with T2D risk in Caucasians and East Asians (OR = 1.12, 95% CI: 1.09-1.16), similar associations are not consistently observed in South Asian and other ethnic populations .

Methodological considerations for cross-ethnic studies:

  • Sample size requirements: Meta-regression analyses have shown that sample sizes of both case and control groups significantly affect the magnitude of genetic effect size

  • Control for confounding factors: BMI of controls has been identified as significantly correlating with the magnitude of genetic effects

  • Standardization of phenotyping: Ensure consistent diagnostic criteria for T2D across studies

Research recommendations:

  • Implement trans-ethnic meta-analysis approaches that account for population structure

  • Consider gene-environment interactions specific to different populations

  • Develop ancestry-specific reference panels for imputation

  • Standardize effect size estimation methods across studies

How can recombinant mouse KCNJ11 be used to investigate potential therapeutic interventions?

Recombinant mouse KCNJ11 provides an excellent platform for developing and testing targeted therapeutic approaches for KATP channel-related disorders. A comprehensive research strategy includes:

High-throughput screening approaches:
Establish cell lines stably expressing recombinant mouse KCNJ11 with SUR1 for screening compound libraries. Utilize fluorescence-based assays measuring membrane potential or thallium flux as surrogates for channel activity.

Mutation-specific therapeutic development:
For specific KCNJ11 mutations, tailored therapeutic approaches can be investigated:

  • For mutations causing reduced ATP sensitivity (like R27H or R192H): Test sulfonylurea compounds for their ability to restore normal channel function

  • For trafficking-deficient mutations: Screen chaperone molecules that may improve surface expression

In vivo validation:
Test promising compounds in mouse models expressing the corresponding mutations. Clinical studies have shown that patients with certain KCNJ11 mutations (R27H, R192H) respond well to sulfonylurea treatment, while others (S116F117del) require insulin therapy .

Translational research framework:

  • Establish correlation between in vitro drug responses and clinical outcomes

  • Develop predictive algorithms for personalized treatment selection

  • Investigate combination therapies targeting multiple aspects of channel dysfunction

What are common challenges in expressing functional recombinant mouse KCNJ11?

Researchers frequently encounter several technical challenges when expressing functional recombinant mouse KCNJ11 channels:

Co-expression requirements:
KCNJ11 must be co-expressed with ABCC8/SUR1 to form functional KATP channels . Ensure balanced expression by optimizing plasmid ratios (typically 1:1) or using bicistronic constructs.

Troubleshooting low functional expression:

  • Verify construct sequence integrity, particularly around the pore region

  • Optimize transfection efficiency using methods appropriate for your cell line

  • Include trafficking enhancers in culture medium (e.g., reduced temperature incubation at 30°C)

  • Consider cell line-specific factors that might affect expression

Quality control measures:

  • Confirm protein expression by Western blotting before functional studies

  • Verify membrane localization using confocal microscopy of tagged constructs

  • Include positive controls (well-characterized KCNJ11 constructs) in all experiments

How can I differentiate between KCNJ11 and other inward rectifier channels in research applications?

Distinguishing KCNJ11-encoded KATP channels from other inwardly rectifying potassium channels requires a multi-faceted approach:

Pharmacological profile:
KATP channels have a distinctive pharmacological signature:

  • Inhibition by sulfonylureas (glibenclamide IC50 ≈ 1-10 nM)

  • Activation by potassium channel openers (diazoxide, pinacidil)

  • Sensitivity to ATP inhibition (IC50 ≈ 10-50 μM for wild-type channels)

Electrophysiological characteristics:

  • Single-channel conductance of approximately 70-80 pS in symmetrical 140 mM K⁺

  • Characteristic inward rectification at positive potentials

  • Distinctive "bursting" gating behavior

Molecular identification:

  • RT-PCR with KCNJ11-specific primers

  • Immunodetection using antibodies selective for Kir6.2

  • Loss of function confirmation using KCNJ11 knockout models or siRNA-mediated knockdown

What are emerging areas of research for recombinant mouse KCNJ11?

The study of recombinant mouse KCNJ11 continues to evolve, with several promising research frontiers:

Systems biology approaches:
Integrate KCNJ11 channel function into broader signaling networks governing insulin secretion and glucose homeostasis. This requires multimodal data collection spanning from molecular interactions to physiological responses.

Tissue-specific functional variations:
While pancreatic β-cell KATP channels are well-studied, KCNJ11 functions in other tissues (neurons, cardiac cells, skeletal muscle) remain less characterized. Comparative studies of tissue-specific regulation may reveal novel therapeutic targets.

Development of precision medicine applications:
Expanding our understanding of genotype-phenotype correlations for KCNJ11 variants will enable more personalized therapeutic approaches. Research should focus on developing functional assays that predict clinical responses to channel modulators.

Novel regulatory mechanisms:
Recent evidence suggests post-translational modifications may fine-tune KATP channel function. Investigating how phosphorylation, SUMOylation, and other modifications affect mouse KCNJ11 could reveal new regulatory paradigms.

How can single-cell approaches enhance our understanding of KCNJ11 function?

Single-cell technologies offer unprecedented opportunities to understand heterogeneity in KCNJ11 expression and function:

Single-cell transcriptomics:
Apply scRNA-seq to investigate cell-to-cell variation in KCNJ11 expression within pancreatic islets or other tissues. This approach can reveal subpopulations with distinct expression patterns and correlate these with functional differences.

Patch-seq integration:
Combine electrophysiological recording with single-cell RNA sequencing to directly correlate channel properties with transcriptomic profiles. This powerful approach allows identification of genes that co-regulate with KCNJ11 or modify channel function.

Live-cell imaging approaches:
Develop fluorescent sensors for monitoring KATP channel activity in living cells. This enables real-time visualization of channel dynamics in response to metabolic changes or pharmacological interventions.

Methodological considerations:

  • Careful tissue dissociation to preserve cell viability and native channel properties

  • Appropriate normalization strategies to account for technical variation

  • Integration of multiple data types (transcriptomic, electrophysiological, metabolic)

  • Advanced computational approaches for identifying functional relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.