Recombinant Mouse ATP-sensitive inward rectifier potassium channel 11 (Kcnj11) is a protein expressed in E. coli that functions as an ATP-sensitive inward rectifier potassium channel . Kcnj11 is also known as Inward rectifier K(+) channel Kir6.2 or Potassium channel, inwardly rectifying subfamily J member 11 .
| Category | Property |
|---|---|
| Catalog Number | RFL25622MF |
| Species | Mus musculus |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-390 amino acids) |
| Form | Lyophilized powder |
| Amino Acid Sequence | MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALT LASSRGPLRKRSVAVAKAKPKFSISPDSLS |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, avoid freeze-thaw cycles |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL |
Association with Type 2 Diabetes (T2D): Meta-analysis suggests an association between KCNJ11 polymorphism (rs5219) and the risk of T2D in East Asian and global populations . A meta-analysis of 40 case-control studies found an association of KCNJ11 rs5219 with type 2 diabetes .
Impact on Cognitive Function: KCNJ11 gene mutations are the most common cause of permanent neonatal diabetes, and individuals with these mutations may exhibit lower IQ scores and reduced attention spans .
Role in Epilepsy: Studies suggest a potential role for KCNJ11 in epilepsy, with research focusing on the development of antiseizure drugs that may interact with KCNJ11-related pathways .
Antineoplastic Target: Potassium ion channels, including KCNJ11, have been identified as potential targets in cancer biology, suggesting that KCNJ11 may play a role in antineoplastic approaches for diseases such as breast cancer .
| Population Group | Odds Ratio (OR) | 95% Confidence Interval (CI) |
|---|---|---|
| South Asian | 0.98 | 0.83–1.16 |
| Indian Subgroup | 1.04 | 0.95–1.15 |
| Pooled Data | 1.12 | 1.10–1.15 |
KCNJ11 encodes the Kir6.2 subunit of ATP-sensitive potassium channels (KATP), which play a crucial role in glucose-mediated metabolic signaling pathways. In mouse models, KCNJ11 forms the channel pore while ABCC9 (SUR1) is required for activation and regulation . These channels have a greater tendency to allow potassium to flow into cells rather than out of them, with voltage dependence regulated by extracellular potassium concentration .
In pancreatic β-cells, KCNJ11-encoded channels are essential for insulin secretion regulation. Studies in Kir6.2 knockout mice have demonstrated that both glucose- and tolbutamide-induced insulin secretion, membrane depolarization, and calcium influx into β-cells are defective, confirming that insulin secretion regulation depends on KATP channel activity .
Mouse and human KCNJ11 share high sequence homology and functional conservation. Both encode the Kir6.2 subunit that forms the pore of ATP-sensitive potassium channels. The core functional domains are well-preserved across species, including:
The transmembrane domains forming the channel pore
ATP-binding sites that mediate channel inhibition
Interaction sites with sulfonylurea receptor (SUR) proteins
For functional studies of recombinant mouse KCNJ11, several expression systems have proven effective, each with distinct advantages depending on research objectives:
Mammalian cell lines: HEK293 and COS-7 cells are commonly used for electrophysiological studies and protein interaction analyses. For functional expression, co-transfection with ABCC8 (SUR1) is typically necessary, as demonstrated in previous research protocols . Plasmid constructs containing mouse KCNJ11 cDNA subcloned into expression vectors like pCMV yield reliable expression.
Methodology note: When generating expression constructs, site-directed mutagenesis using single-stranded templates of pCMV KCNJ11 prepared with helper phage R408 has proven effective for creating both wild-type and mutant channels .
For comprehensive functional characterization of recombinant mouse KCNJ11 channels, the following electrophysiological approaches are recommended:
Patch-clamp techniques: Whole-cell patch-clamp recording remains the gold standard for assessing channel function. For KATP channels, inside-out patch configuration is particularly valuable as it allows direct manipulation of the intracellular environment to test ATP sensitivity.
ATP sensitivity (IC50 values)
Single-channel conductance
Open probability
Rectification properties
Response to pharmacological modulators
Co-expression with SUR1 is essential for proper channel function
Standardized pipette and bath solutions should contain (in mM): 140 KCl, 10 HEPES, 1 EGTA (pH 7.3) for pipette; and 140 KCl, 10 HEPES, 1 MgCl2, 1 CaCl2 (pH 7.3) for bath
ATP titration experiments should use concentrations ranging from 0.001 to 10 mM
All recordings should be performed at room temperature (22-24°C)
To systematically evaluate how mutations affect mouse KCNJ11 channel function, implement the following comprehensive approach:
Step 1: Create mutant constructs
Generate mutant KCNJ11 constructs using site-directed mutagenesis. For example, studies have created mutations corresponding to human variants like R27H, R192H, and S116F117del .
Step 2: Functional characterization
Perform electrophysiological recordings to assess:
ATP sensitivity (shifts in dose-response curves)
Channel gating kinetics
Trafficking to cell membrane
Step 3: Molecular modeling
Complement experimental data with molecular modeling to understand structural implications. Previous research has shown that mutations like R192H can significantly affect the ATP-binding pocket, explaining observed decreases in ATP sensitivity .
Results interpretation framework:
The functional impact of mutations can be classified into categories based on experimental outcomes:
Loss-of-function mutations: No detectable channel currents (e.g., S116F117del)
Reduced ATP sensitivity: Detectable currents with altered ATP dose-response (e.g., R27H, R192H)
Trafficking defects: Reduced surface expression despite normal channel properties
Altered pharmacological responses: Changed sensitivity to sulfonylureas or other modulators
Mouse KCNJ11 models offer valuable platforms for investigating the functional consequences of diabetes-associated polymorphisms. A systematic research approach includes:
Generation of knock-in mouse models:
Create knock-in mice expressing KCNJ11 variants corresponding to human polymorphisms (e.g., E23K) using CRISPR-Cas9 genome editing. This allows assessment of variant effects in a physiologically relevant context.
Glucose homeostasis: Perform glucose tolerance tests, insulin tolerance tests, and measure fasting blood glucose levels
Insulin secretion: Isolate pancreatic islets for ex vivo glucose-stimulated insulin secretion assays
Electrophysiological assessment: Compare KATP channel activity in islet β-cells from wild-type and knock-in mice
Examine β-cell mass and morphology
Assess β-cell apoptosis rates (elevated apoptosis has been observed in Kir6.2G132S transgenic mice before hyperglycemia onset)
Evaluate calcium signaling in response to glucose
Data interpretation framework:
Integrate findings across multiple scales (molecular, cellular, physiological) to establish causal relationships between KCNJ11 variants and diabetic phenotypes.
Research on KCNJ11 polymorphisms has revealed significant heterogeneity in their association with type 2 diabetes across ethnic populations, presenting several methodological challenges:
Heterogeneity in genetic associations:
Meta-analyses have demonstrated that while the E23K polymorphism (rs5219) shows significant association with T2D risk in Caucasians and East Asians (OR = 1.12, 95% CI: 1.09-1.16), similar associations are not consistently observed in South Asian and other ethnic populations .
Sample size requirements: Meta-regression analyses have shown that sample sizes of both case and control groups significantly affect the magnitude of genetic effect size
Control for confounding factors: BMI of controls has been identified as significantly correlating with the magnitude of genetic effects
Standardization of phenotyping: Ensure consistent diagnostic criteria for T2D across studies
Implement trans-ethnic meta-analysis approaches that account for population structure
Consider gene-environment interactions specific to different populations
Develop ancestry-specific reference panels for imputation
Standardize effect size estimation methods across studies
Recombinant mouse KCNJ11 provides an excellent platform for developing and testing targeted therapeutic approaches for KATP channel-related disorders. A comprehensive research strategy includes:
High-throughput screening approaches:
Establish cell lines stably expressing recombinant mouse KCNJ11 with SUR1 for screening compound libraries. Utilize fluorescence-based assays measuring membrane potential or thallium flux as surrogates for channel activity.
Mutation-specific therapeutic development:
For specific KCNJ11 mutations, tailored therapeutic approaches can be investigated:
For mutations causing reduced ATP sensitivity (like R27H or R192H): Test sulfonylurea compounds for their ability to restore normal channel function
For trafficking-deficient mutations: Screen chaperone molecules that may improve surface expression
In vivo validation:
Test promising compounds in mouse models expressing the corresponding mutations. Clinical studies have shown that patients with certain KCNJ11 mutations (R27H, R192H) respond well to sulfonylurea treatment, while others (S116F117del) require insulin therapy .
Establish correlation between in vitro drug responses and clinical outcomes
Develop predictive algorithms for personalized treatment selection
Investigate combination therapies targeting multiple aspects of channel dysfunction
Researchers frequently encounter several technical challenges when expressing functional recombinant mouse KCNJ11 channels:
Co-expression requirements:
KCNJ11 must be co-expressed with ABCC8/SUR1 to form functional KATP channels . Ensure balanced expression by optimizing plasmid ratios (typically 1:1) or using bicistronic constructs.
Verify construct sequence integrity, particularly around the pore region
Optimize transfection efficiency using methods appropriate for your cell line
Include trafficking enhancers in culture medium (e.g., reduced temperature incubation at 30°C)
Consider cell line-specific factors that might affect expression
Confirm protein expression by Western blotting before functional studies
Verify membrane localization using confocal microscopy of tagged constructs
Include positive controls (well-characterized KCNJ11 constructs) in all experiments
Distinguishing KCNJ11-encoded KATP channels from other inwardly rectifying potassium channels requires a multi-faceted approach:
Pharmacological profile:
KATP channels have a distinctive pharmacological signature:
Inhibition by sulfonylureas (glibenclamide IC50 ≈ 1-10 nM)
Activation by potassium channel openers (diazoxide, pinacidil)
Sensitivity to ATP inhibition (IC50 ≈ 10-50 μM for wild-type channels)
Single-channel conductance of approximately 70-80 pS in symmetrical 140 mM K⁺
Characteristic inward rectification at positive potentials
Distinctive "bursting" gating behavior
RT-PCR with KCNJ11-specific primers
Immunodetection using antibodies selective for Kir6.2
Loss of function confirmation using KCNJ11 knockout models or siRNA-mediated knockdown
The study of recombinant mouse KCNJ11 continues to evolve, with several promising research frontiers:
Systems biology approaches:
Integrate KCNJ11 channel function into broader signaling networks governing insulin secretion and glucose homeostasis. This requires multimodal data collection spanning from molecular interactions to physiological responses.
Tissue-specific functional variations:
While pancreatic β-cell KATP channels are well-studied, KCNJ11 functions in other tissues (neurons, cardiac cells, skeletal muscle) remain less characterized. Comparative studies of tissue-specific regulation may reveal novel therapeutic targets.
Development of precision medicine applications:
Expanding our understanding of genotype-phenotype correlations for KCNJ11 variants will enable more personalized therapeutic approaches. Research should focus on developing functional assays that predict clinical responses to channel modulators.
Novel regulatory mechanisms:
Recent evidence suggests post-translational modifications may fine-tune KATP channel function. Investigating how phosphorylation, SUMOylation, and other modifications affect mouse KCNJ11 could reveal new regulatory paradigms.
Single-cell technologies offer unprecedented opportunities to understand heterogeneity in KCNJ11 expression and function:
Single-cell transcriptomics:
Apply scRNA-seq to investigate cell-to-cell variation in KCNJ11 expression within pancreatic islets or other tissues. This approach can reveal subpopulations with distinct expression patterns and correlate these with functional differences.
Patch-seq integration:
Combine electrophysiological recording with single-cell RNA sequencing to directly correlate channel properties with transcriptomic profiles. This powerful approach allows identification of genes that co-regulate with KCNJ11 or modify channel function.
Live-cell imaging approaches:
Develop fluorescent sensors for monitoring KATP channel activity in living cells. This enables real-time visualization of channel dynamics in response to metabolic changes or pharmacological interventions.
Careful tissue dissociation to preserve cell viability and native channel properties
Appropriate normalization strategies to account for technical variation
Integration of multiple data types (transcriptomic, electrophysiological, metabolic)
Advanced computational approaches for identifying functional relationships