Recombinant Mouse ATP-sensitive inward rectifier potassium channel 12 (Kcnj12)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ATP-Sensitive Inward Rectifier Potassium Channel 12 (Kcnj12)

The Recombinant Mouse ATP-sensitive inward rectifier potassium channel 12, commonly referred to as Kcnj12, is a genetically engineered version of the Kcnj12 protein found in mice. Kcnj12 encodes an inwardly rectifying potassium channel, specifically contributing to the cardiac inwardly rectifying potassium current (I<sub>K1</sub>) . These channels are characterized by their ability to allow potassium ions to flow more easily into the cell than out of it, a process modulated by intracellular ATP levels .

Gene and Protein Structure

The Kcnj12 gene is a member of the inwardly rectifying potassium channel subfamily . The protein it encodes, Kir2.2, plays a vital role in maintaining the resting membrane potential and shaping the action potential in electrically excitable cells . The structure of the channel allows potassium to flow into the cell, which is crucial for stabilizing the resting membrane potential .

Function and Mechanism

Kcnj12 channels are critical in maintaining the I<sub>K1</sub>, which stabilizes the resting membrane potential . This stabilization is essential for the proper electrical excitability of cells, particularly in cardiac tissue. The inward rectification property ensures that potassium influx is favored over efflux, contributing to the repolarization phase of action potentials .

Role in Diseases

Mutations in the KCNJ12 gene have been associated with several diseases, particularly those affecting the cardiovascular system .

  • Dilated Cardiomyopathy (DCM): Studies have identified KCNJ12 mutations in families with DCM, a condition characterized by the enlargement of the heart and impaired pumping function . A specific mutation, p.Glu334del, has been identified as a candidate mutation contributing to familial DCM .

  • Periodic Paralysis: Genetic variants in KCNJ12 have been linked to a susceptibility to sporadic periodic paralysis .

  • Skin Cancers and Vascular Development: KCNJ12 mutations have been found in skin cancers and may play a role in vascular development . It has been suggested that KCNJ12 may modulate the AKT signaling pathway, which is implicated in bladder cancer oncogenesis and metastasis .

Research Methods for Studying Kcnj12

Several advanced molecular biology and genetic techniques are employed to study Kcnj12 and its associated mutations:

  • Whole Exome Sequencing (WES): This method is used to identify genetic variations in the coding regions of the genome. WES has been instrumental in identifying KCNJ12 mutations in DCM patients .

  • Sanger Sequencing: Used to validate candidate mutations identified through WES. Sanger sequencing confirms the presence of heterozygous mutations like p.Glu334del in affected family members .

  • Electrophysiology: Techniques such as patch-clamp electrophysiology are used to study the functional properties of Kcnj12 channels, including their conductance, rectification, and sensitivity to ATP .

  • Animal Models: Genetically modified animal models, such as mice lacking Kir6.1, are used to study the effects of Kcnj12 deficiency on cardiac function and other physiological processes .

Table of KCNJ12 Mutations and Associated Diseases

MutationAssociated DiseaseReference
p.Glu334delFamilial Dilated Cardiomyopathy
Nonsynonymous SNPDilated Cardiomyopathy
Indel MutationDilated Cardiomyopathy
Thr140MetSporadic Periodic Paralysis
Novel Genetic VariationPrader-Willi Syndrome (PWS)

Potential Therapeutic Applications

Given the role of KCNJ12 in various diseases, it is a potential therapeutic target.

  • Gene Therapy: Correcting KCNJ12 mutations through gene therapy could be a potential treatment for DCM and periodic paralysis.

  • Pharmacological Modulation: Developing drugs that modulate the activity of KCNJ12 channels could help manage diseases associated with KCNJ12 dysfunction. For example, activators or inhibitors could restore normal channel function in cardiac or cancer cells .

  • Targeting AKT Pathway: Since KCNJ12 may modulate the AKT signaling pathway, targeting this pathway could be a therapeutic strategy for diseases like bladder cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnj12; Irk2; ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+ channel Kir2.2; IRK-2; Potassium channel, inwardly rectifying subfamily J member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj12
Target Protein Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR TPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMNGAI MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK DLVENKFLLPSANSFCYENELAFLIRDEEDEVSTDRDVRTPQPEHDFDRLQASSAALVRP YRRESEI
Uniprot No.

Target Background

Function

This inward-rectifying potassium channel (Kir2.2), activated by phosphatidylinositol 4,5-bisphosphate, likely regulates resting membrane potential in electrically excitable cells. It is involved in action potential waveform and excitability in neuronal and muscle tissues. Inward rectifier potassium channels preferentially allow potassium influx. Their voltage dependence is modulated by extracellular potassium concentration; increased extracellular potassium shifts the voltage range of channel opening to more positive potentials. Inward rectification is primarily attributed to internal magnesium block of outward current.

Gene References Into Functions
  1. Kir2.2 in the brainstem plays a transient role in hypercapnic ventilatory response, potentially through central ventilatory chemosensitivity, during postnatal development. PMID: 15705530
  2. Biophysical measurements and computer simulations of prelimbic and infralimbic cortex slices suggest a dynamic interplay between Kir2, Kleak, and HCN channel currents in shaping membrane potential and temporal integration of synaptic potentials. PMID: 16177047
  3. Kir2 channels exhibit two states with differing sensitivities to internal cationic blockers. PMID: 17640933
Database Links

KEGG: mmu:16515

STRING: 10090.ENSMUSP00000086588

UniGene: Mm.4970

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ12 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest level in cerebellum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.