Recombinant Mouse ATP-sensitive inward rectifier potassium channel 14 (Kcnj14)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant Kcnj14 is typically expressed in bacterial systems (e.g., E. coli) with His-tagged purification for structural and functional studies. Below are key applications and production parameters:

ParameterDetailsSource
Expression SystemE. coli (full-length or truncated variants)
Purification TagN-terminal His-tag for affinity chromatography
Purity>90% as confirmed by SDS-PAGE
ApplicationsAntibody validation, electrophysiology, structural biology

Functional Partners and Interaction Networks

Recombinant Kcnj14 is studied for its interactions with other ion channels and signaling proteins. Below is a curated list of functional partners identified in mouse models :

PartnerFunctionInteraction Score
Kcnq2Voltage-gated K⁺ channel (M-current regulation)0.928
Kcnq3Voltage-gated K⁺ channel (neuronal excitability)0.911
Kcnq5Voltage-gated K⁺ channel (M-current modulation)0.927
GnaqG-protein subunit (signaling pathway regulation)0.909
Scn4aVoltage-gated Na⁺ channel (muscle excitability)0.562

Key Insights:

  • Neuronal Regulation: Partners with Kcnq2/3 to form heterotetramers, influencing neuronal excitability .

  • Muscle Function: Interacts with Scn4a in skeletal muscle, linking K⁺ and Na⁺ channel activities .

Role in Physiological Processes

  • Neuronal Excitability: Modulates action potential waveforms and synaptic responsiveness via K⁺ influx .

  • Cardiac Rhythm: Associated with Andersen syndrome, a disorder linked to cardiac arrhythmias and muscle weakness .

Cancer-Related Dysregulation

While not directly tied to recombinant Kcnj14, native KCNJ14 is implicated in oncogenesis:

  • Expression Patterns: Upregulated in lung, colorectal, and stomach cancers; downregulated in breast and thyroid tumors .

  • Prognostic Value: High expression correlates with poor survival in adrenocortical carcinoma, kidney cancer, and glioma .

Challenges and Future Directions

  1. Species-Specific Data: Limited direct studies on mouse recombinant Kcnj14; most insights derive from human/rat orthologs .

  2. Functional Validation: Requires electrophysiological assays (e.g., patch-clamp) to confirm channel activity in vitro .

  3. Therapeutic Potential: KCNJ14’s role in cancer stemness and immunotherapy response warrants further investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Kcnj14; Irk4; ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+ channel Kir2.4; IRK-4; Potassium channel, inwardly rectifying subfamily J member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj14
Target Protein Sequence
MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGSRRRGRFVKKDGHCNVR FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPP PPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG AVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVI LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS AKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQEEDEEEDTKEGTSAETPERAAS PQALTPTLALTLPP
Uniprot No.

Target Background

Function

Inward rectifier potassium channels exhibit a preferential influx of potassium ions into the cell. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification primarily results from intracellular magnesium blockage of outward current. KCNJ14 encodes low-conductance channels with low affinity for the channel blockers barium and cesium.

Gene References Into Functions
  1. Data suggest an interaction between the rectifying potassium channel Kir2.4 and the G-protein subunit Gαo. PMID: 23339194
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Kcnj14 differ from other potassium channel family members?

Kcnj14 (Kir2.4) belongs to the classical Kir channels subgroup of the inwardly rectifying potassium channel family. While it shares structural similarities with other family members, Kcnj14 gives rise to low-conductance channels with a notably low affinity to common channel blockers such as Barium and Cesium .

The inward-rectifier potassium channel family includes three main subgroups:

  • Strong inward-rectifier channels (Kir2.x) - to which Kcnj14 belongs

  • G-protein-activated inward-rectifier channels (Kir3.x)

  • ATP-sensitive channels (Kir6.x), which combine with sulfonylurea receptors

This classification is based on functional properties and physiological roles rather than just sequence homology.

What pathways is Kcnj14 involved in?

According to pathway analyses, Kcnj14 participates in several significant cellular and physiological processes:

Pathway NameRelated Proteins
Classical Kir channelsKCNJ4, KCNJ2A, KCNJ2, KCNJ12
Neuronal SystemCPLX1, KCNA2, KCNK3A, KCNV2, KCNK1, KCNK1A, GJC1, SLC1A2B, CHRND, STXBP1A
Oxytocin signaling pathwayACTG1, SRC, CACNB3, RGS2, CALML5, PIK3CA, ELK1, PPP3CA, CACNB4, NFATC3
Cholinergic synapseBCL2, PIK3R5, PIK3R3, CHRM5, PRKACG, CHRNB4, SLC5A7, CHRM4, NRAS, MAP2K1
Inwardly rectifying K+ channelsKCNJ11, GNGT2A, KCNJ1A.6, KCNJ2A, ABCC9, KCNJ15, KCNJ1B, KCNJ1A.2, GNGT2B, KCNJ10
Potassium ChannelsKCNQ2, ABCC9, KCNA6A, KCNK1B, KCNB2, KCNK10B, KCNN2, KCNN1, KCNV2, KCNG1

These pathways implicate Kcnj14 in diverse physiological processes including neuronal signaling, muscle function, and cellular metabolism regulation .

What expression systems are most effective for producing functional recombinant mouse Kcnj14?

For producing functional recombinant mouse Kcnj14, mammalian expression systems, particularly HEK293 cells, have proven most effective. This system ensures proper protein folding, post-translational modifications, and membrane insertion critical for channel functionality. Several commercially available recombinant mouse Kcnj14 proteins are expressed in HEK293 cells with various tags (His, Fc, Avi) .

The optimal approach involves:

  • Gene synthesis or cloning of the full mouse Kcnj14 coding sequence (1-434 amino acids)

  • Insertion into a mammalian expression vector with appropriate tags (His, Fc, or Avi tags are commonly used)

  • Transfection into HEK293 cells

  • Protein purification via one-step affinity chromatography

  • Verification of purity (≥85-90%) using SDS-PAGE and Western blot analysis

This methodology ensures reliable expression of functional channel proteins suitable for downstream applications including structural studies, antibody production, and functional assays.

What are the optimal methods for measuring Kcnj14 channel activity in experimental settings?

Measuring Kcnj14 channel activity requires specialized electrophysiological techniques due to its unique properties as an inwardly rectifying potassium channel. The most effective methods include:

When designing these experiments, it's critical to consider that Kcnj14 channels exhibit inward rectification and are regulated by extracellular K+ concentration, intracellular Mg2+, and potentially nucleotides .

How should I design experiments to investigate the interaction between Kcnj14 and potential regulatory proteins?

To investigate interactions between Kcnj14 and potential regulatory proteins, a multi-faceted approach is recommended:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged Kcnj14 (e.g., His-Fc-Avi-tagged) in HEK293 cells

    • Immunoprecipitate using tag-specific antibodies

    • Analyze co-precipitated proteins by mass spectrometry or Western blotting

    • Validate with reciprocal Co-IP using antibodies against the interacting protein

  • Proximity labeling approaches:

    • Fuse Kcnj14 to BioID or APEX2

    • Express in relevant cell types

    • Identify proximal proteins via streptavidin pulldown followed by mass spectrometry

  • Functional validation:

    • Co-express Kcnj14 with potential interacting proteins in heterologous systems

    • Measure channel activity using patch-clamp electrophysiology

    • Compare biophysical properties (conductance, rectification, nucleotide sensitivity) with and without interacting proteins

  • Fluorescence resonance energy transfer (FRET):

    • Create fluorescent protein fusions with Kcnj14 and potential interacting proteins

    • Measure FRET efficiency to determine proximity in living cells

While designing these experiments, consider that Kcnj14 is an integral membrane protein, and interactions may be dependent on membrane localization, lipid environment, and cellular metabolic state .

How do mutations in Kcnj14 affect channel function and physiology?

Mutations in Kcnj14 can significantly alter channel function through several mechanisms:

  • Altered nucleotide sensitivity: Mutations may modify the channel's response to cellular ATP/ADP ratios. In analogous channels like Kir6.2 (KCNJ11), mutations that reduce ATP inhibition lead to gain-of-function effects, resulting in conditions such as neonatal diabetes .

  • Changed conductance or rectification properties: Mutations in the pore region or in domains affecting magnesium blockade can alter the fundamental conduction properties of the channel. This may disrupt the typical inward rectification characteristic of Kcnj14.

  • Trafficking defects: Some mutations may affect channel assembly, membrane targeting, or surface expression rather than directly altering channel biophysics.

  • Altered protein-protein interactions: Mutations may disrupt associations with regulatory partners or scaffolding proteins.

The physiological consequences of such mutations would depend on the tissues where Kcnj14 plays critical roles. For example, mutations affecting Kcnj14 function in neurons could potentially alter neuronal excitability, affecting motor neuron function, as Kcnj14 likely has a role in controlling motor neuron excitability .

Experimental approaches to characterize such mutations should include:

  • Site-directed mutagenesis followed by expression in heterologous systems

  • Detailed electrophysiological characterization

  • Trafficking studies using fluorescently tagged constructs

  • In vivo expression of mutant channels in animal models

What is the physiological role of nucleotide regulation in Kcnj14 channel function?

While direct evidence for nucleotide regulation of Kcnj14 is limited in the provided search results, we can draw insights from the well-characterized nucleotide regulation of related KATP channels:

KATP channels are regulated by intracellular nucleotides through:

  • Inhibitory ATP binding: ATP binds to the channel (typically the Kir subunit) and inhibits channel activity

  • Stimulatory Mg-nucleotide binding: MgADP (and other Mg-nucleotides) bind to the regulatory subunit (e.g., SUR in Kir6.x channels) and activate the channel

This dual regulation allows KATP channels to serve as metabolic sensors, coupling cellular energetic state to membrane excitability .

For Kcnj14 specifically, research should focus on:

  • Determining if Kcnj14 exhibits ATP sensitivity similar to Kir6.x channels

  • Identifying whether Kcnj14 associates with regulatory subunits that confer nucleotide sensitivity

  • Investigating how metabolic stress affects Kcnj14 activity in relevant cell types

  • Examining whether Kcnj14 contributes to metabolic sensing in neurons or other cell types

Notably, some inward rectifier channels classified as "nucleotide-dependent" K+ channels (KNDP) require nucleotide diphosphates in the presence of Mg2+ to open , a property that may apply to Kcnj14.

How does Kcnj14 interact with the cellular metabolic machinery in different tissues?

Understanding how Kcnj14 interacts with cellular metabolic machinery requires investigation of tissue-specific expression, regulation, and functional coupling:

  • Expression patterns:

    • Determine cellular and subcellular localization of Kcnj14 in different tissues

    • Compare expression levels across tissues under various metabolic conditions

  • Metabolic coupling:

    • Investigate whether Kcnj14 activity responds to changes in:

      • ATP/ADP ratios

      • Glycolytic intermediates

      • Redox state (NAD+/NADH ratio)

      • pH fluctuations

  • Interactome analysis:

    • Identify tissue-specific Kcnj14 interacting proteins

    • Focus on potential interactions with metabolic enzymes, signaling molecules, and scaffolding proteins

  • Functional studies:

    • Measure Kcnj14 activity during metabolic challenges (hypoxia, glucose deprivation)

    • Determine if Kcnj14 contributes to metabolic protection mechanisms similar to other KATP channels

  • Comparison with other inwardly rectifying channels:

    • Compare Kcnj14 properties with well-characterized metabolic sensors like Kir6.2/SUR complexes

While direct evidence for Kcnj14's role in metabolic coupling is limited, related KATP channels are known to play critical roles in coupling metabolism to membrane excitability, particularly during metabolic stress conditions like hypoxia and ischemia .

What are the best techniques for studying Kcnj14 trafficking and membrane insertion?

Studying Kcnj14 trafficking and membrane insertion requires specialized techniques that address both the dynamic process of channel movement and its final localization:

  • Fluorescent protein tagging:

    • Generate Kcnj14 constructs with GFP, mCherry, or other fluorescent protein tags

    • Use confocal microscopy to track movement through cellular compartments

    • Perform live-cell imaging to observe real-time trafficking

  • Surface biotinylation assays:

    • Use cell-impermeable biotinylation reagents to label surface proteins

    • Pull down biotinylated proteins with streptavidin

    • Quantify surface Kcnj14 by Western blotting

  • Immunocytochemistry with compartment markers:

    • Co-stain for Kcnj14 and markers of:

      • Endoplasmic reticulum (e.g., calnexin)

      • Golgi apparatus (e.g., GM130)

      • Endosomes (e.g., Rab5, Rab7)

      • Plasma membrane (e.g., Na+/K+-ATPase)

  • Total internal reflection fluorescence (TIRF) microscopy:

    • Visualize Kcnj14 specifically at or near the plasma membrane

    • Track single-channel insertion events in real-time

  • Electrophysiological approaches:

    • Measure current density in response to trafficking manipulations

    • Use combinations of selective inhibitors to assess functional channels at different locations

These techniques should be applied with consideration for the potential regulatory mechanisms of Kcnj14 trafficking, which may include phosphorylation states, interaction with scaffolding proteins, and metabolic dependencies .

How can I establish physiologically relevant models to study Kcnj14 function in motor neurons?

To establish physiologically relevant models for studying Kcnj14 function in motor neurons, consider the following approaches:

  • Primary motor neuron cultures:

    • Isolate spinal cord motor neurons from embryonic or neonatal mice

    • Maintain in neurotrophic factor-supplemented media

    • Verify Kcnj14 expression through qPCR and immunostaining

    • Perform patch-clamp electrophysiology to characterize native Kcnj14 currents

  • Motor neuron differentiation from stem cells:

    • Differentiate mouse embryonic stem cells (ESCs) or induced pluripotent stem cells (iPSCs) into motor neurons

    • Follow established protocols using retinoic acid and Sonic hedgehog pathway activators

    • Characterize differentiated cells for motor neuron markers (e.g., Hb9, Islet1, ChAT)

    • Validate functional Kcnj14 expression

  • Transgenic mouse models:

    • Generate conditional Kcnj14 knockout mice using Cre-loxP technology

    • Create motor neuron-specific deletion using ChAT-Cre or Hb9-Cre driver lines

    • Develop mice expressing tagged or mutant Kcnj14 for in vivo tracking

    • Analyze motor function using behavioral tests

  • Ex vivo preparations:

    • Prepare spinal cord slices preserving motor neuron circuits

    • Record from identified motor neurons

    • Pharmacologically isolate Kcnj14-mediated currents

  • Optogenetic approaches:

    • Combine channelrhodopsin expression with Kcnj14 manipulation in motor neurons

    • Precisely control neuronal activity while measuring Kcnj14-dependent effects

Since Kcnj14 likely plays a role in controlling motor neuron excitability , these models will help elucidate its specific contributions to motor neuron function in both physiological and pathological conditions.

What techniques are available for high-throughput screening of compounds that modulate Kcnj14 activity?

High-throughput screening (HTS) for Kcnj14 modulators requires specialized techniques that balance throughput with physiological relevance:

  • Automated patch-clamp platforms:

    • Express recombinant Kcnj14 in cell lines (HEK293 recommended)

    • Use parallel recording systems (e.g., QPatch, Patchliner)

    • Apply voltage protocols optimized for inward rectifier currents

    • Screen 100-1000 compounds per day with direct electrophysiological readout

  • Thallium (Tl+) flux assays:

    • Load Kcnj14-expressing cells with Tl+-sensitive fluorescent dyes

    • Measure Tl+ influx as a surrogate for K+ channel activity

    • Adapt to 384- or 1536-well format for true HTS capacity

    • Can screen >10,000 compounds per day

  • Membrane potential dye assays:

    • Use voltage-sensitive fluorescent dyes in Kcnj14-expressing cells

    • Optimize conditions to detect hyperpolarization upon channel activation

    • Miniaturize to multi-well format

  • Bioluminescence resonance energy transfer (BRET)-based assays:

    • Design constructs where conformational changes in Kcnj14 alter BRET efficiency

    • Optimize for detection in 384-well format

    • Useful for both activator and inhibitor screening

  • Yeast-based screening systems:

    • Engineer yeast to express functional Kcnj14

    • Design growth-based selection strategies

    • Allow screening of large compound libraries or genetic modifier screens

When developing these assays, it's important to include appropriate controls:

  • Known K+ channel blockers (Ba2+, Cs+) as reference inhibitors, noting Kcnj14's lower affinity for these blockers

  • Secondary confirmation assays to validate hits

  • Counter-screens to eliminate compounds with non-specific effects

Follow-up characterization of hits should include detailed electrophysiological analysis using patch-clamp techniques to confirm direct modulation of Kcnj14 activity .

What is known about the role of Kcnj14 in neurological disorders?

While direct evidence linking Kcnj14 to specific neurological disorders is limited in the provided search results, several lines of evidence suggest potential involvement:

  • Expression and function in neurons: Kcnj14 likely plays a role in controlling the excitability of motor neurons , suggesting that dysfunction could contribute to disorders affecting motor control.

  • Role in neuronal systems: Kcnj14 is involved in pathways related to the neuronal system , including potential roles in:

    • Cholinergic synapses

    • Neural excitability regulation

    • Neuronal responses to metabolic stress

  • Analogous channelopathies: Related inwardly rectifying potassium channels are implicated in various neurological disorders:

    • KCNJ2 mutations cause Andersen-Tawil syndrome with periodic paralysis

    • KCNJ11 mutations can cause developmental delay and epilepsy as part of DEND syndrome (Developmental delay, Epilepsy, and Neonatal Diabetes)

  • Potential therapeutic target: The role of Kcnj14 in controlling neuronal excitability suggests it could be a target for disorders characterized by abnormal neuronal activity.

Research priorities should include:

  • Comprehensive expression analysis of Kcnj14 in the nervous system

  • Investigation of Kcnj14 variants in patients with relevant neurological disorders

  • Development of animal models with Kcnj14 mutations

  • Electrophysiological characterization of neuronal Kcnj14 currents in health and disease

How can Kcnj14 function be precisely modulated for potential therapeutic applications?

Precisely modulating Kcnj14 function for therapeutic applications requires multifaceted approaches:

  • Pharmacological modulation:

    • Develop specific small molecule modulators through structure-based drug design

    • Focus on compounds that can distinguish Kcnj14 from other Kir family members

    • Consider allosteric modulators that modify channel gating rather than directly blocking the pore

    • Target unique structural features of Kcnj14, noting its distinctive low affinity for classic blockers like barium and cesium

  • Genetic approaches:

    • Design antisense oligonucleotides or siRNAs for targeted Kcnj14 knockdown

    • Develop CRISPR-based strategies for correcting pathogenic mutations

    • Consider viral vector delivery of wild-type or engineered Kcnj14 for gene therapy

  • Optogenetic and chemogenetic control:

    • Engineer light-sensitive Kcnj14 variants for precise temporal control

    • Develop chemically-activated Kcnj14 channels for pharmaceutical regulation

  • Selective targeting strategies:

    • Leverage tissue-specific expression patterns

    • Develop cell-specific delivery systems

    • Design compounds that preferentially accumulate in target tissues

  • Combination therapies:

    • Target multiple components of pathways involving Kcnj14

    • Consider combining Kcnj14 modulators with drugs affecting downstream signaling

Each approach must consider the physiological context of Kcnj14 function, particularly its role in controlling excitability in neurons and potential roles in metabolic coupling .

What experimental approaches can determine if Kcnj14 dysfunction contributes to neurodegenerative diseases?

To investigate potential contributions of Kcnj14 dysfunction to neurodegenerative diseases, consider these experimental approaches:

  • Human genetic association studies:

    • Perform targeted sequencing of KCNJ14 in patient cohorts with relevant neurodegenerative diseases

    • Conduct genome-wide association studies with specific focus on KCNJ14 locus

    • Analyze rare variants and their functional consequences

  • Expression studies in disease tissue:

    • Examine Kcnj14 expression in post-mortem brain tissue from patients

    • Use single-cell RNA sequencing to identify cell type-specific alterations

    • Perform protein-level quantification through Western blotting and immunohistochemistry

  • Animal models:

    • Generate Kcnj14 knockout or transgenic mouse models

    • Induce neurodegenerative disease conditions in these models

    • Assess whether Kcnj14 modification accelerates, attenuates, or does not affect disease progression

    • Evaluate behavioral, electrophysiological, and neuropathological outcomes

  • Cellular models:

    • Culture neurons from Kcnj14-modified animals

    • Examine vulnerability to neurodegenerative stressors (e.g., excitotoxicity, protein aggregates)

    • Use patient-derived iPSCs differentiated into neurons for disease modeling

  • Functional studies focusing on excitotoxicity:

    • Investigate Kcnj14's role in neuronal calcium homeostasis

    • Examine contribution to excitotoxic cell death mechanisms

    • Assess involvement in metabolic stress responses in neurons

  • Therapeutic intervention studies:

    • Test whether Kcnj14 modulators affect disease progression in animal models

    • Develop and evaluate selective Kcnj14 modulators in cellular and animal models

These approaches should be integrated to provide converging evidence regarding Kcnj14's potential role in neurodegenerative processes, particularly focusing on diseases affecting motor neurons, given Kcnj14's likely role in controlling motor neuron excitability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.