Recombinant Mouse ATP-sensitive inward rectifier potassium channel 1 (Kcnj1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ATP-sensitive Inward Rectifier Potassium Channel 1 (Kcnj1)

The protein "Recombinant Mouse ATP-sensitive inward rectifier potassium channel 1 (Kcnj1)" refers to a specific type of potassium channel protein, specifically the inwardly rectifying potassium channel subfamily J member 1 (KCNJ1) found in mice that has been produced using recombinant DNA technology . Inwardly rectifying potassium channels, in general, are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it .

Functional Aspects of Kcnj1

KCNJ1, also known as Kir1.1 or ROMK (renal outer medullary K+ channel), plays a vital role in potassium transport within the kidney . It is predominantly expressed in the apical membrane of specific cells within the kidney tubules, such as the thick ascending limb (TAL) of Henle's loop and the cortical collecting duct .

  • Role in Renal Function KCNJ1 participates in the recycling of potassium within the TAL, which energizes the Na-K-2Cl co-transporter (NKCC2). This process is critical for NaCl reabsorption, a key function of the loop diuretics . In the connecting tubule and collecting duct, KCNJ1 mediates potassium secretion and is coupled with sodium reabsorption. Sodium reabsorption depolarizes the luminal membrane potential, thereby increasing the electrochemical driving force for KCNJ1-dependent potassium secretion .

Genetic and Molecular Details

The KCNJ1 gene encodes the Kir1.1 protein, and it is located on chromosome 11 in humans . The study of KCNJ1 has provided insights into the genetic heterogeneity of certain conditions, such as Bartter's syndrome .

Kcnj1 as a Drug Target

Given its roles in sodium reabsorption and potassium secretion, KCNJ1 is considered a potential target for novel diuretic drugs. Blocking KCNJ1 could induce natriuresis and diuresis without the potassium-wasting side effects associated with current diuretics .

Diseases Associated with KCNJ1 Mutations

Mutations in KCNJ1 are associated with several conditions, highlighting its clinical significance :

  • Bartter's Syndrome This is a group of rare genetic disorders that affect the kidneys' ability to reabsorb salt, leading to an imbalance of electrolytes. Studies have identified genetic mutations in KCNJ1 as a cause of Bartter's syndrome .

  • Hypertension Research suggests that KCNJ1 is one of the genes protective of hypertension in the general population .

Research and Clinical Findings

StudyFindings
Hebert, S.C. Curr. Opin. Nephrol. Hypertens.(2003) Established the genetic heterogeneity of Bartter's syndrome and demonstrated the physiological role of ROMK in vivo.
Cho, J.T., Guay-Woodford, L.M. J. Korean Med. Sci.(2003) Reported heterozygous mutations of the gene for Kir 1.1 (ROMK) in antenatal Bartter syndrome presenting with transient hyperkalemia, evolving to a benign course.
Liu, X., Singh, B.B., Ambudkar, I.S. J. Biol. Chem.(1999) Showed ATP-dependent activation of K(Ca) and ROMK-type K(ATP) channels in human submandibular gland ductal cells.
Peters, M., et al.(2006) Described the clinical presentation of genetically defined patients with hypokalemic salt-losing tubulopathies.
Konrad, M., et al.(1999) Discussed prenatal and postnatal management of hyperprostaglandin E syndrome after genetic diagnosis from amniocytes.
Kahle, K.T., et al. (2004) Indicated that WNK4 regulates apical and basolateral Cl- flux in extrarenal epithelia.
Henderson, R.M., et al.(1996) Used atomic force microscopy to image ROMK1 inwardly rectifying ATP-sensitive K+ channel protein.
Gamba, G. Am. J. Physiol. Renal Physiol.(2005) Reviewed the role of WNK kinases in regulating tubular salt and potassium transport and in the development of hypertension.
Cope, G., Golbang, A., O'Shaughnessy, K.M. Pharmacol. Ther.(2005) Discussed WNK kinases and the control of blood pressure.
Leng, Q., Kahle, K.T., et al. J. Physiol. (Lond.)(2006) Showed that WNK3, a kinase related to genes mutated in hereditary hypertension with hyperkalemia, regulates the K+ channel ROMK1 (Kir1.1).
Yano, H., Philipson, L.H., et al.Mol. Pharmacol.(1994) Reported alternative splicing of human inwardly rectifying K+ channel ROMK1 mRNA.
Krishnan, S.N., Desai, T., et al.Hum. Genet.(1995) Reported the isolation and chromosomal localization of a human ATP-regulated potassium channel.
Xu, Z.C., Yang, Y., Hebert, S.C. J. Biol. Chem.(1996) Discussed the phosphorylation of the ATP-sensitive, inwardly rectifying K+ channel, ROMK, by cyclic AMP-dependent protein kinase.
Sterling, H., Lin, D.H., et al.Am. J. Physiol. Renal Physiol.(2003) Found that tetanus toxin abolishes exocytosis of ROMK1 induced by inhibition of protein tyrosine kinase.
Lin, D., Sterling, H., et al.J. Biol. Chem.(2002) Showed that protein kinase C (PKC)-induced phosphorylation of ROMK1 is essential for the surface expression of ROMK1 channels.
O'Connell, A.D., Leng, Q., et al.Proc. Natl. Acad. Sci. U.S.A.(2005) Found a phosphorylation-regulated endoplasmic reticulum retention signal in the renal outer-medullary K+ channel (ROMK).
Yoo, D., Flagg, T.P., et al.J. Biol. Chem.(2004) Reported the assembly and trafficking of a multiprotein ROMK (Kir 1.1) channel complex by PDZ interactions.
Cope, G., Murthy, M., et al.J. Am. Soc. Nephrol.(2006) Discovered that WNK1 affects surface expression of the ROMK potassium channel independent of WNK4.
Vollmer, M., Koehrer, M., et al.Pediatr. Nephrol.(1998) Discovered two novel mutations of the gene for Kir 1.1 (ROMK) in neonatal Bartter syndrome.
Cader, Z.M., Noble-Topham, S., et al.Hum. Mol. Genet.(2003) Showed significant linkage to migraine with aura on chromosome 11q24.
Bock, J.H., Shuck, M.E., et al.Gene(1997) Conducted nucleotide sequence analysis of the human KCNJ1 potassium channel locus.
Károlyi, L., Koch, M.C., et al.J. Mol. Med.(1998) Provided the molecular genetic approach to "Bartter's syndrome".
Pabon, A., Chan, K.W., et al.J. Biol. Chem.(2000) Found that glycosylation of GIRK1 at Asn119 and ROMK1 at Asn117 has different consequences in potassium channel function.
Bock, J.H., Shuck, M.E., et al. Gene(1997) Conducted nucleotide sequence analysis of the human KCNJ1 potassium channel locus.
Kahle, K.T., et al. Proc. Natl. Acad. Sci. U.S.A.(2004) Indicated that WNK4 regulates apical and basolateral Cl- flux in extrarenal epithelia.
Huang, C.L., J Am Soc Nephrol. (2007)Reviewed the regulation of renal K+ channels in hypertension.
Hoorn EJ, et al. J Am Soc Nephrol. (2016)Studied the clinical significance of ROMK mutations.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnj1; ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+ channel Kir1.1; Potassium channel, inwardly rectifying subfamily J member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj1
Target Protein Sequence
MFKHLRRWFVTHIFGRSRQRARLVSKDGRCNIEFGNVDAQSRFIFFVDIWTTVLDLKWRY KMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTPCVENINGMTSAFLFSLETQ VTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAV ISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGETIILDQTNINFVVDAGNEN LFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGTVESTSATCQVRTSYIPEEV LWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFV LSEVDETDDTQM
Uniprot No.

Target Background

Function
In the kidney, this protein likely plays a crucial role in potassium homeostasis. Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium ion blockage. This channel is activated by intracellular ATP and can be inhibited by extracellular barium.
Gene References Into Functions
  1. ENaC and ROMK channel activity in kidney tubules are inhibited in TgWnk4 (pseudoaldosteronism type II) mice. WNK4 (PHAII)-mediated inhibition of ENaC and ROMK may contribute to suppressed K+ secretion in the tubules. PMID: 28365586
  2. Animal knockouts of ROMK1 do not exhibit a Bartter phenotype. ROMK1 is essential for K+ secretion in the collecting tubule in response to high K+ intake. PMID: 26728465
  3. Lovastatin stimulates ROMK1 channels by inducing PI(4,5)P2 synthesis, suggesting potential for reducing cyclosporine-induced nephropathy. PMID: 25349201
  4. miR-194 regulates ROMK channel activity by modulating ITSN1 expression, thereby influencing ITSN1/WNK-dependent endocytosis. PMID: 24197061
  5. Hypertension-resistance sequence variants inhibit ROMK channel function through various mechanisms. PMID: 20926634
  6. Knockout mice exhibit impaired renal NaCl absorption, modeling type II Bartter's syndrome. PMID: 12122007
  7. Absence of small conductance K+ channel (SK) activity in apical membranes of the thick ascending limb and cortical collecting duct in knockout mice models Bartter's disease. PMID: 12130653
  8. ROMK is required for functional expression of the 70-pS K+ channel in the thick ascending limb. PMID: 14600033
  9. Mutant WNK4 does not dominantly affect the cellular localization of kidney ROMK. PMID: 15907795
  10. The plasma membrane expression of ROMK channels is regulated by PTK, SGK, and with-no-lysine kinase 4. Monoubiquitination of ROMK channels regulates their surface expression. PMID: 16339961
  11. Potassium absorption in the loop of Henle is reduced in Romk-deficient mice, accounting for significant renal potassium loss. PMID: 16710355
  12. NaCl-induced hypertonicity augments ROMK mRNA expression in the renal medullary tubule by stimulating ROMK gene transcription; TonEBP and the p38 MAPK and ERK pathways are involved. PMID: 17003571
  13. Potassium restriction suppresses the expression of PP2B catalytic subunits, and PP2B inhibition decreases ROMK channel activity. PMID: 18184875
  14. Adaptive changes in Romk(-/-) mice may limit renal Na+ loss. PMID: 18322017
  15. Na+ and K+ excretion are significantly blunted in Romk(-/-) mice, indicating a major salt transport defect in the thick ascending limb. PMID: 18385266
  16. Female ROMK null mice exhibit a more severe Bartter phenotype, potentially due to increased PGE2 and TXB2 production. PMID: 18579648
  17. KS-WNK1 is a key physiological regulator of renal K+ excretion, likely through its effects on the ROMK1 channel. PMID: 19244242
  18. Cortical collecting duct cells exhibit significant K+ secretion, likely mediated by ROMK, which is not stimulated by aldosterone but is increased by high K+ concentration exposure. PMID: 19297448
  19. In taste buds, ROMK in type I/glial-like cells may function homeostatically, excreting excess K+ and allowing excitable taste cells to maintain a hyperpolarized resting membrane potential. PMID: 19708028
  20. ARH targets ROMK for clathrin-dependent endocytosis, coordinating with potassium homeostasis demands. PMID: 19841541
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of mouse Kcnj1?

Kcnj1 (ROMK1) was the first member of the inward rectifying K+ channel family to be cloned. The channel's topology consists of two transmembrane domains flanking a single, highly conserved pore region with intracellular N- and C-termini . Like other potassium channels, the functional unit is composed of four subunits that can assemble as homo- or heterotetramers.

What are the expression patterns of Kcnj1 in mouse kidney?

Kcnj1 is strongly expressed in the kidney, particularly in the apical membrane of several kidney segments . Immunohistochemical staining of rat kidney sections shows strong expression in tubular epithelial cells of distal tubules, while no staining is observed in proximal tubules . The channel is particularly abundant in the thick ascending limb of Henle's loop, connecting tubule, and cortical collecting duct.

In the thick ascending limb, Kcnj1 is co-expressed with other transporters like NKCC2 (encoded by Slc12a1), which is essential for salt reabsorption. These expression patterns are important for understanding the physiological role of Kcnj1 in kidney function.

How can Kcnj1 function be studied in primary cell cultures?

To study Kcnj1 function in vitro, primary cultures of mouse thick ascending limb (mTAL) cells represent an excellent model system. These cultures maintain physiological expression of Kcnj1 and other TAL-specific transporters. Key methodological approaches include:

  • Isolation and culture of mTAL cells: This involves microdissection of TAL segments from mouse kidneys, enzymatic digestion, and culture in appropriate growth medium .

  • Pharmacological manipulation: Researchers can use ROMK inhibitors to study channel function. For example, studies have shown that incubating mTAL cells with VU591 (a ROMK inhibitor) at 10-60 μM reduces uromodulin excretion while increasing cellular uromodulin levels (186 ± 15% of vehicle control at 60 μM) .

  • Genetic manipulation: Targeted deletion of Kcnj1 in mTAL cells can be achieved using Cre-lox systems with inducible promoters such as the Pax8 promoter .

What methodologies are most effective for generating and validating recombinant mouse Kcnj1?

Generation of recombinant mouse Kcnj1 typically involves:

  • Cloning approach: The full-length Kcnj1 coding sequence can be amplified from mouse kidney cDNA and inserted into appropriate expression vectors. GST fusion proteins containing specific Kcnj1 sequences can be used for generating antibodies or studying protein interactions .

  • Expression systems: Mammalian expression systems (HEK293, CHO cells) are preferred for functional studies as they provide appropriate post-translational modifications.

  • Validation methods:

    • Western blot analysis: Anti-Kcnj1 antibodies (such as #APC-001) can detect the channel in rat kidney membranes and other tissues .

    • Electrophysiological assays: Patch-clamp recordings to verify channel conductance and rectification properties.

    • Immunofluorescence: Confirming proper localization to plasma membrane.

  • Knockout validation: Antibody specificity can be verified using Kcnj1 knockout tissues, where the signal should be absent .

How do Kcnj1 knockout models affect uromodulin processing and excretion?

Studies with Kcnj1 knockout mice have revealed important insights into the relationship between this channel and uromodulin (Tamm-Horsfall protein) processing:

  • Global Kcnj1 knockout effects:

    • Reduced urinary levels of uromodulin (60 ± 5% of control)

    • Increased total kidney uromodulin levels (300 ± 29% of control)

    • Accumulation in both membrane (232 ± 24% of control) and cytosolic (1389 ± 433% of control) fractions

  • Conditional knockout models: Inducible, kidney-specific Kcnj1 KO mice (using Pax8rtTA/LC-1 system) also showed significant reduction in urinary uromodulin (75 ± 3% of control), confirming that these effects are directly related to Kcnj1 deletion and not secondary to systemic effects .

  • Cellular mechanisms: Confocal microscopy reveals that in Kcnj1−/− mice, uromodulin shows similar localization at or near the apical membrane of TAL cells as in wild-type mice, but with more intense signal, suggesting intracellular accumulation .

  • N-glycosylation patterns: Urinary uromodulin from Kcnj1−/− mice retains similar N-glycosylation patterns to wild-type, as PNGase F treatment leads to a ~30 kDa shift in both genotypes .

ParameterKcnj1+/+ (Control)Kcnj1−/− (Knockout)P value
Urinary uromodulin (WB)100%41 ± 11%p < 0.001
Urinary uromodulin (ELISA)102 ± 12 μg/mg creat.51 ± 4.0 μg/mg creat.p < 0.001
Kidney uromodulin levels100%300 ± 29%p < 0.001
Membrane fraction uromodulin100%232 ± 24%p < 0.01
Cytosolic fraction uromodulin100%1389 ± 433%p = 0.003

How do mutations in Kcnj1 lead to Bartter syndrome phenotypes in mouse models?

Bartter syndrome is an autosomal recessive disorder characterized by metabolic alkalosis, hypokalemia, hypercalciuria, and other electrolyte abnormalities. The relationship between Kcnj1 mutations and Bartter syndrome can be studied using various approaches:

  • Phenotypic characterization of knockout models: Kcnj1−/− mice display several features similar to human Bartter syndrome, including:

    • Polyuria with diluted urine

    • Mild hypokalemia (lower plasma K+ concentration)

    • Metabolic abnormalities

  • Physiological measurements: Key parameters to assess in these models include:

    • Body weight and growth

    • Blood urea nitrogen (BUN) and creatinine clearance

    • Plasma and urinary electrolyte concentrations

    • Acid-base status (blood pH, bicarbonate levels)

  • Molecular pathways: Studies suggest that Kcnj1 deficiency affects:

    • Expression of other TAL transporters (downregulation of Slc12a1, upregulation of Clcnkb and Cldn16)

    • NKCC2 trafficking and function

    • Salt reabsorption in the TAL

  • Translational relevance: Mouse models help understand human disease, where compound heterozygous mutations in KCNJ1 (like p.Thr234Ile/p.Thr71Met) cause Bartter syndrome with hypokalemia, metabolic alkalosis, hypercalciuria, hyperparathyroidemia, and hyper-reninemia .

What experimental approaches can clarify the functional interactions between Kcnj1 and uromodulin?

The relationship between Kcnj1 and uromodulin appears complex and can be investigated through several complementary approaches:

  • Cell-based studies: Primary cultures of mouse TAL cells offer insights into molecular mechanisms:

    • Pharmacological inhibition of ROMK with specific inhibitors (VU591) reduces uromodulin excretion dose-dependently while increasing cellular uromodulin levels

    • Genetic deletion of Kcnj1 in mTAL cells using conditional knockout approaches demonstrates direct causality

  • Co-immunoprecipitation experiments: To detect potential physical interactions between Kcnj1 and uromodulin or intermediary proteins.

  • Subcellular fractionation: Separating membrane and cytosolic fractions helps track uromodulin distribution, revealing that Kcnj1 deletion affects both compartments with particularly dramatic increases in cytosolic uromodulin (1389 ± 433% of control) .

  • Confocal microscopy: Visualizing the co-localization and trafficking of both proteins in TAL cells from wild-type and knockout animals.

  • Glycosylation analysis: Investigating whether Kcnj1 affects post-translational modifications of uromodulin through techniques like PNGase F treatment and glycosylation-specific antibodies .

What are the most reliable antibodies and detection methods for mouse Kcnj1?

Several validated antibodies and detection methods have been established for Kcnj1 research:

  • Antibodies:

    • Anti-KCNJ1 (Kir1.1) Antibody (#APC-001) from Alomone Labs is a highly specific rabbit polyclonal antibody directed against rat KCNJ1

    • This antibody recognizes a GST fusion protein corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560)

  • Detection techniques:

    • Western blot: Effective for rat kidney membranes at 1:200 dilution

    • Immunohistochemistry: Shows strong staining of tubular epithelial cells in distal tubes

    • Specificity controls: Preincubation with KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001) eliminates specific staining

  • Application in various tissues:

    • Has been validated in rat kidney lysate (4 μg Ab/mg protein)

    • Used successfully in rat mTAL cells (1:200 dilution)

    • Also effective in human submandibular gland (HSG) cells (1:200 dilution)

How can genetic variants in Kcnj1 be effectively analyzed and validated?

For analyzing and validating Kcnj1 genetic variants, several approaches have proven effective:

  • Sequencing methodology:

    • PCR amplification of coding regions followed by Sanger sequencing

    • Next-generation sequencing panels that include KCNJ1 and other related genes (SLC12A1, SLC12A3, CLCNKB, BSND, CASR)

    • High-throughput sequencing platforms like BGISEQ-500

  • Bioinformatics analysis:

    • Alignment to reference genome using tools like Burrows-Wheeler Aligner

    • Variant calling with SOAPsnp software and SAMtools

    • Filtering against databases (NCBI dbSNP, HapMap, 1000 human genome dataset)

  • Prediction of variant effects:

    • In silico prediction programs (Scale Invariant Feature Transform, PolyPhen-2, LRT, MutationTaster, PhyloP)

    • Assessment using protocols from The American College of Medical Genetics

  • Functional validation:

    • Expression of variant channels in heterologous systems

    • Electrophysiological analysis of channel function

    • Cell-based assays to assess trafficking and surface expression

How does potassium status influence Kcnj1 function and uromodulin processing?

Recent findings suggest an important relationship between potassium status, Kcnj1 function, and uromodulin processing that warrants further investigation:

  • Molecular mechanisms: Evidence indicates that ROMK deficiency significantly impacts uromodulin handling:

    • Kcnj1 knockout leads to reduced urinary uromodulin excretion

    • This is accompanied by intracellular accumulation of uromodulin in TAL cells

  • Experimental approaches to study this relationship:

    • Dietary potassium manipulation in wild-type and Kcnj1 mutant mice

    • Pharmacological modulation of ROMK activity

    • Cell culture models with controlled extracellular potassium concentrations

  • Clinical relevance: Understanding these mechanisms could provide insights into:

    • Renal potassium handling disorders

    • Pathophysiology of hypercalciuria and nephrocalcinosis

    • New therapeutic targets for Bartter syndrome and related disorders

What are the implications of Kcnj1 research for understanding human renal diseases?

Kcnj1 research has significant implications for human disease:

  • Bartter syndrome: Mutations in human KCNJ1 cause type II Bartter syndrome:

    • Compound heterozygous mutations (e.g., p.Thr234Ile/p.Thr71Met) have been identified in patients

    • These mutations lead to hypokalemia, metabolic alkalosis, hypercalciuria, hyper-reninemia, hyperaldosteronism, and nephrocalcinosis

  • Therapeutic approaches informed by basic research:

    • Potassium supplementation is effective in treating hypokalemia in Bartter syndrome patients

    • Normalization of serum potassium improves polyuria and polydipsia symptoms

  • Translational research opportunities:

    • Development of specific ROMK modulators for treating hypokalemic disorders

    • Gene therapy approaches for correcting specific KCNJ1 mutations

    • Personalized treatment strategies based on specific genetic variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.