Recombinant Mouse ATP synthase protein 8 (Mtatp8)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Mtatp8 is typically expressed in E. coli systems for research purposes. Key steps include:

  • Codon optimization for bacterial expression .

  • Affinity tagging (e.g., His-tag) for purification .

  • Mitochondrial targeting sequences (e.g., ATP5G1MTS) to ensure proper localization in transgenic models .

A study demonstrated successful incorporation of epitope-tagged Mtatp8 into ATP synthase in transgenic mice, confirming functional integration .

Metabolic and Inflammatory Studies

  • Immune Modulation: A natural mt-Atp8 mutation (m.7778G>T) in mice altered CD4+ T-cell metabolism, reducing susceptibility to inflammatory skin diseases .

  • ATP Synthase Function: Recombinant Mtatp8 restored ATP synthase activity in mitochondria with defective endogenous subunits, highlighting therapeutic potential .

Key Research Findings

  • Allotopic Expression: Transgenic mice expressing nuclear-encoded Mtatp8 showed no significant disruption in oxidative phosphorylation, supporting gene therapy approaches for mitochondrial diseases .

  • Disease Models: The m.8528T>C mutation in Mtatp8 causes severe cardiomyopathy due to disrupted proton channel function .

  • Metabolic Profiling: Mtatp8 variants alter systemic propionate levels, linking mitochondrial function to immune metabolism .

Challenges and Future Directions

  • Expression Variability: Transgenic Mtatp8 levels vary between tissues, necessitating optimized delivery systems .

  • Therapeutic Development: Allotopic expression remains experimental, with unresolved issues in protein stoichiometry and long-term efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format needs. Please specify your requirements when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mtatp8; Atp8; mt-Atp8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mtatp8
Target Protein Sequence
MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTMKVKTPWELKWTKIYLPHSLPQQ
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is created by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. The protein is part of the complex F(0) domain. It is a minor subunit located within the membrane with subunit a.
Gene References Into Functions
  1. Data show that the ATP synthase 8, mouse (mtATP8) nt7778 G/T polymorphism is associated with reduced hemoglobin content in erythrocytes. PMID: 27815458
  2. The mutation provides partial protection against endotoxemic stress. PMID: 21167184
  3. The mtAtp8 polymorphism influences mitochondrial performance, leading to increased H(2)O(2) production and alterations in mitochondrial structure. PMID: 19759059
Database Links
Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant mitochondrial proteins like Mtatp8?

The optimal expression system depends on your specific research requirements. For mitochondrial proteins like Mtatp8:

  • Yeast expression systems offer an economical and efficient eukaryotic platform for both secretion and intracellular expression. These systems can provide post-translational modifications (glycosylation, acylation, phosphorylation) to ensure near-native protein conformation .

  • Mammalian cell systems produce very high-quality proteins closest to the natural form but come with higher costs and more demanding culture conditions .

  • E. coli systems are suitable for some applications but may lack the post-translational modification machinery needed for full functionality of mitochondrial proteins.

For allotopic expression studies, codon optimization of the mitochondrial gene is critical, as demonstrated in transgenic mouse models where a codon-optimized ATP8 gene was successfully expressed from the nucleus .

How should recombinant Mtatp8 be stored and handled to maintain activity?

Based on established protocols for similar mitochondrial proteins:

  • Store lyophilized protein at -20°C for long-term storage

  • For extended preservation, maintain at -80°C

  • Prepare working aliquots and store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability and activity

  • When rehydrating, use a Tris-based buffer with approximately 50% glycerol to maintain protein integrity

How can I verify successful mitochondrial localization of allotopically expressed Mtatp8?

Verification of mitochondrial localization requires multiple complementary approaches:

  • Subcellular fractionation: Isolate mitochondria using Dounce homogenization followed by differential centrifugation to separate mitochondrial fractions from other cellular components.

  • Western blotting analysis: Use antibodies against both the epitope tag (if present in your construct) and mitochondrial markers like aconitase to confirm presence in mitochondrial fractions.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique allows visualization of intact protein complexes and can confirm incorporation of recombinant Mtatp8 into ATP synthase monomers and dimers. Look for co-migration with other ATP synthase subunits such as ATP5O/OSCP and ATP6 .

  • Immunofluorescence microscopy: Use confocal microscopy with appropriate antibodies to visualize co-localization of tagged Mtatp8 with established mitochondrial markers.

Research has shown that utilizing a mitochondrial targeting sequence (MTS), such as that from the nuclear-encoded ATP synthase subunit ATP5G1, significantly improves mitochondrial localization of recombinant ATP8 .

What are the best approaches for quantifying incorporation of exogenous Mtatp8 into functional ATP synthase complexes?

Quantification of incorporation requires multiple analytical techniques:

  • Denaturing PAGE followed by western blotting: This allows ratiometric analysis of exogenous versus endogenous ATP8 by normalizing band intensities to housekeeping proteins (for whole cell lysates) or mitochondrial markers like aconitase (for purified mitochondria) .

  • BN-PAGE combined with in-gel activity assays: This technique can assess whether incorporated recombinant Mtatp8 affects the enzymatic activity of the ATP synthase complex.

  • Mass spectrometry: For precise quantification, targeted proteomics approaches can determine the exact ratio of exogenous to endogenous Mtatp8 within isolated ATP synthase complexes.

It's important to note that densitometry analysis of western blots is semi-quantitative, and determining exact incorporation ratios may require complementary techniques. In transgenic models, exogenous ATP8 has been observed at approximately twice the amount of endogenous ATP8 in some tissues .

MethodAdvantagesLimitationsBest For
Western blot densitometryRelatively simple, widely accessibleSemi-quantitative, variation between replicatesInitial screening
BN-PAGE with activity assaysPreserves complex integrity, links structure to functionTechnically challengingFunctional assessment
Mass spectrometryHighly precise, can distinguish similar proteinsExpensive, requires specialized equipmentDefinitive quantification

How can I assess the functional impact of recombinant Mtatp8 on ATP synthase activity?

Functional assessment should include:

  • ATP synthase enzymatic activity assays: Measure ATP production rates in isolated mitochondria from tissues expressing recombinant Mtatp8 compared to controls.

  • Oxygen consumption measurements: Use high-resolution respirometry to assess the impact on oxidative phosphorylation capacity.

  • Membrane potential analysis: Evaluate if recombinant Mtatp8 affects the proton gradient across the inner mitochondrial membrane using fluorescent probes.

  • Mitochondrial stress testing: Apply compounds that specifically affect ATP synthase function (oligomycin, etc.) to determine if recombinant Mtatp8 alters sensitivity to these agents.

Research has demonstrated that properly incorporated allotopically expressed ATP8 maintains ATP synthase activity comparable to non-transgenic controls, suggesting successful integration and function .

What considerations are critical when designing constructs for allotopic expression of Mtatp8?

When designing constructs for nuclear expression of mitochondrially-encoded ATP8:

  • Codon optimization: Mitochondria use a different genetic code than the nucleus. Recoding the gene according to nuclear codon usage is essential for effective expression.

  • Mitochondrial targeting sequence (MTS): Include an effective N-terminal MTS from a nuclear-encoded mitochondrial protein, such as ATP5G1, to ensure proper trafficking to mitochondria .

  • Epitope tagging: Consider adding C-terminal tags (MYC, FLAG) for immunodetection, ensuring they don't interfere with protein function or import.

  • Promoter selection: Choose a promoter that provides appropriate expression levels (e.g., CAG promoter has been successfully used in transgenic models) .

  • Integration strategy: For stable expression, targeted integration into a "safe harbor" locus like ROSA26 has proven effective in mouse models .

A successful construct design used in research is: ATP5G1MTS-oATP8-FLAG, where oATP8 represents the codon-optimized ATP8 sequence .

How can I evaluate competition between endogenous and exogenous Mtatp8 in mitochondria?

Competition between native and recombinant Mtatp8 can be evaluated through:

  • Natural polymorphism models: Utilize models with known polymorphisms in mitochondrial ATP8 (like the C57BL/6J(mtFVB) mouse strain with the m.7778 G>T polymorphism) to distinguish between endogenous and exogenous proteins .

  • RT-qPCR analysis: Monitor whether expression of recombinant Mtatp8 affects transcription levels of endogenous mitochondrial genes (ATP8, ATP6) .

  • Protein turnover studies: Use pulse-chase experiments to determine if exogenous Mtatp8 affects the half-life of endogenous protein.

  • Quantitative proteomics: Apply stable isotope labeling techniques to precisely measure the relative abundance of both proteins over time.

Research has shown that in some models, the proportion of transgenic ATP8 was significantly higher in mitochondria with mutant endogenous ATP8, suggesting preferential incorporation under certain conditions .

What are common challenges in achieving mitochondrial localization of recombinant Mtatp8?

Several factors can impede successful mitochondrial localization:

  • Ineffective MTS: The mitochondrial targeting sequence may not be optimal for the specific recombinant protein. Consider testing multiple MTS options derived from different nuclear-encoded mitochondrial proteins.

  • Protein aggregation: Hydrophobic proteins like Mtatp8 may aggregate in the cytosol before reaching mitochondria. Modifying expression conditions or adding solubility-enhancing tags may help.

  • Improper folding: Mitochondrial proteins synthesized in the cytosol may adopt incorrect conformations. Co-expression with appropriate chaperones might improve folding.

  • Import saturation: Excessive expression can overwhelm the mitochondrial import machinery. Titrating expression levels using inducible systems can help identify optimal conditions.

  • Cell type specificity: Import efficiency varies across tissues. Research has shown differential incorporation of exogenous ATP8 across tissues in transgenic models .

How can I differentiate between effects of recombinant Mtatp8 expression and experimental artifacts?

To distinguish genuine biological effects from artifacts:

  • Include multiple controls: Use both non-transgenic animals/cells and those expressing non-functional Mtatp8 variants.

  • Perform dose-response experiments: Test different expression levels of recombinant Mtatp8 to identify threshold effects.

  • Cross-validate with complementary techniques: For example, confirm ATP synthase activity measurements with both biochemical assays and functional respirometry.

  • Test in multiple models: Verify observations across different cell types or animal models to ensure reproducibility.

  • Time-course studies: Monitor effects over extended periods to distinguish transient adaptations from persistent biological impacts. Studies have monitored transgenic animals for up to 50 weeks to evaluate long-term effects .

How can recombinant Mtatp8 be used to study mitochondrial permeability transition?

Mitochondrial ATP synthase has been implicated in forming the permeability transition pore (PTP), which plays a crucial role in cell death mechanisms:

  • Structure-function studies: Recombinant Mtatp8 variants can help determine the role of specific residues in PTP formation and regulation.

  • Interaction analyses: Investigate potential interactions between Mtatp8 and other key PTP regulators like cyclophilin D (CyPD), which is known to bind to the F₀F₁ ATP synthase .

  • Calcium sensitivity assays: Examine how recombinant Mtatp8 variants affect the calcium threshold for PTP opening.

  • Pharmacological studies: Test if Mtatp8 overexpression alters sensitivity to PTP modulators like cyclosporin A or Bz-423 .

This approach can provide insights into both fundamental mitochondrial biology and pathological conditions involving mitochondrial dysfunction.

What is the potential of allotopic expression of Mtatp8 for treating mitochondrial disorders?

Allotopic expression of mitochondrial genes like ATP8 represents a promising therapeutic approach:

  • Proof-of-concept: Successful incorporation of nuclear-expressed ATP8 into functional ATP synthase complexes demonstrates the feasibility of this approach for treating mtDNA mutations .

  • Mutation bypass: When properly targeted to mitochondria, nuclear-encoded ATP8 can potentially compensate for dysfunctional mitochondrial-encoded protein.

  • Safety profile: Research in transgenic animals has shown no detectable negative impact on measured mitochondrial function, metabolism, or behavior, suggesting the approach may be safe for long-term application .

  • Delivery considerations: For clinical applications, determining the optimal gene delivery method (viral vectors, etc.) and targeting specific tissues affected by mitochondrial dysfunction remain critical challenges.

  • Long-term expression: Transgenic studies have demonstrated stable expression and transmission of the allotopic gene for up to four generations, indicating durability of the intervention .

What emerging technologies might enhance the study and application of recombinant Mtatp8?

Several cutting-edge approaches show promise:

  • CRISPR-based mitochondrial targeting: New techniques for directly editing mitochondrial DNA could complement allotopic expression approaches.

  • Single-molecule imaging: Advanced microscopy techniques could visualize the incorporation of individual Mtatp8 molecules into ATP synthase complexes in living cells.

  • Organoid models: Testing recombinant Mtatp8 expression in organ-specific organoids derived from patients with mitochondrial disorders could provide personalized insights.

  • Nanobody-based detection: Developing highly specific nanobodies against Mtatp8 could improve detection sensitivity and enable novel therapeutic approaches.

  • Computational modeling: Molecular dynamics simulations of Mtatp8 incorporation into ATP synthase could predict optimal construct designs and interaction properties.

How might recombinant Mtatp8 contribute to understanding aging processes?

Mitochondrial dysfunction is a hallmark of aging, and recombinant Mtatp8 studies could provide insights through:

  • mtDNA mutation models: Testing whether allotopic expression of ATP8 can rescue age-associated accumulation of mtDNA mutations.

  • Bioenergetic decline: Evaluating if supplementation with nuclear-encoded ATP8 can ameliorate the decline in ATP production observed with aging.

  • Mitochondrial dynamics: Investigating how recombinant Mtatp8 affects age-related changes in mitochondrial fusion, fission, and mitophagy.

  • Oxidative stress: Determining if optimized ATP synthase function through recombinant Mtatp8 reduces reactive oxygen species production in aging tissues.

  • Lifespan studies: Conducting comprehensive analyses of whether allotopic expression of ATP8 and other mitochondrial genes can extend healthspan or lifespan in model organisms.

Research has already established that allotopic expression provides a potential route toward repairing physiological consequences of mtDNA defects that accumulate with age .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.