Recombinant Mouse ATPase family AAA domain-containing protein 3 (Atad3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mouse ATPase family AAA domain-containing protein 3 (Atad3) is a protein that belongs to the AAA ATPase family . ATAD3 proteins are found in eukaryotes, but not in Fungi and Amoebozoa . It is essential for mitochondrial network organization, mitochondrial metabolism, and cell growth at both organism and cellular levels . It may play a role in mitochondrial protein synthesis, participate in mitochondrial DNA replication, bind to mitochondrial DNA D-loops, and contribute to nucleoid stability . ATAD3 is also required for enhanced channeling of cholesterol for hormone-dependent steroidogenesis .

NCBI Information

  • Official Full Name: ATPase family AAA domain-containing protein 3

  • Official Symbol: Atad3a

  • Synonyms: Tob3, Atad3, mKIAA1273, 2400004H09Rik

  • Protein Information: ATPase family AAA domain-containing protein 3

  • UniProt Entry Name: ATAD3_MOUSE

Function and Significance

  • Mitochondrial Organization and Metabolism: Essential for maintaining the structure of the mitochondrial network and ensuring proper metabolic function .

  • Protein Synthesis and DNA Replication: ATAD3 may participate in mitochondrial protein synthesis and DNA replication . It may also bind to mitochondrial DNA D-loops and contribute to nucleoid stability.

  • Cholesterol Transport: Required for the movement of cholesterol into mitochondria, which is important for steroid hormone production .

Role in Disease

Mutations and altered expression of ATAD3 have been linked to various diseases .

  • Neurodevelopmental Disorders: Pathogenic variants in the ATAD3 gene cluster have been associated with different neurodevelopmental disorders showing clinical symptoms like global developmental delay, intellectual disability, hypotonia, and seizures .

  • Cerebellar Dysfunction: Deletions in the ATAD3 gene cluster can cause cerebellar dysfunction, which is associated with altered mitochondrial DNA and cholesterol metabolism .

  • Cancer Progression: ATAD3 expression is linked with the progression of head and neck cancers, non-Hodgkin's lymphoma, and lung cancer .

  • Alzheimer's Disease (AD): ATAD3A oligomerization increased at the MAMs in various AD disease models and the postmortem brains of AD patients .

ATAD3 and Alzheimer's Disease

Research indicates that ATAD3A plays a role in the pathology of Alzheimer's Disease (AD) .

  • Increased ATAD3A Oligomerization: ATAD3A oligomerization increases at the MAMs (mitochondria-associated membranes) in AD disease models and postmortem brains of AD patients .

  • Elevated Immunodensity: Immunohistochemical analysis revealed higher ATAD3A staining in the postmortem hippocampus of AD patients compared to normal subjects .

  • MAM Localization: ATAD3A accumulates at the MAMs in the brains of AD patients and mice .

Impact on Cognition

Reducing ATAD3A oligomerization improves spatial learning and long-term memory in AD mice .

  • Y-Maze and Barnes Maze Tests: Cognitive ability was assessed using Y-maze and Barnes maze tests .

  • Improved Spatial Learning: Reduced ATAD3A oligomerization improved the spatial learning and long-term memory of 5XFAD AD mice .

  • Normalized Activity: ATAD3A fl/+ mice showed a normalized total distance traveled in the open field test similar to that of the WT mice .

ATAD3 and Cholesterol

  • Elevated Cholesterol: Excess membrane-embedded cholesterol is a cellular and pathological abnormality in ATAD3 disease that can cascade to lysosomal abnormalities .

  • Cholesterol Transfer: ATAD3-mediated mitochondrial membrane formation participates in the optimal transfer of cholesterol from the endoplasmic reticulum into mitochondria .

Product Specs

Buffer
Lyophilized from a Tris/PBS-based buffer containing 6% Trehalose, pH 8.0.
Form
Liquid or lyophilized powder.
Note: We will prioritize shipment of the available format. If a specific format is required, please specify this during order placement.
Lead Time
Orders typically ship within 1-3 business days. Delivery times may vary depending on shipping method and location. Please consult your local distributor for specific delivery timelines.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Liquid formulations generally have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag.
Synonyms
Atad3; Atad3a; Kiaa1273; ATPase family AAA domain-containing protein 3; AAA-ATPase TOB3
Datasheet & Coa
Please contact us to get it.
Expression Region
2-591
Protein Length
full length of mature protein
Species
Mus musculus (Mouse)
Target Names
Atad3
Target Protein Sequence
SWLFGIKGPKGEGTGPPLPLPPAQPGAEGGGDRGAGDRPSPKDKWSNFDPTGLERAAKA ARELEHSRHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTE ETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELR HKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFV TDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPI QVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLF AKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRA TEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREER ERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMA YSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERPDSQTNKPPHPSLLSC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

ATPase family AAA domain-containing protein 3 (ATAD3) is essential for mitochondrial network organization, mitochondrial metabolism, and cell growth at both the organismal and cellular levels. It plays a significant role in mitochondrial protein synthesis and may also participate in mitochondrial DNA replication. ATAD3 may bind to mitochondrial DNA D-loops, contributing to nucleoid stability. Furthermore, it is involved in enhanced cholesterol channeling for hormone-dependent steroidogenesis and mitochondrial-mediated antiviral innate immunity.

Gene References Into Functions
  1. Fancd2 localizes to the mitochondrion and associates with nucleoid complex components Atad3 and Tufm. PMID: 28378742
  2. ATAD3-mediated mitochondrial membrane formation is crucial for optimal cholesterol transfer from the endoplasmic reticulum to mitochondria. PMID: 25375035
  3. Studies have confirmed the existence of alternative splicing in rodent ATAD3 mRNA and several mRNA isoforms in humans. PMID: 24239551
  4. ATAD3 is found in five native mitochondrial protein complexes of varying sizes, suggesting complex roles in mitochondrial architecture and function. PMID: 23372768
Database Links
Protein Families
AAA ATPase family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.
Tissue Specificity
Expressed in heart, spleen, kidney, liver and at smaller levels, in lung and muscle (at protein level).

Q&A

What is the cellular localization of ATAD3 and how does it impact experimental design?

ATAD3A is primarily localized at the interface between the inner and outer mitochondrial membranes, with enrichment in mitochondria-associated ER membrane (MAM) fractions . This unique positioning enables ATAD3A to participate in critical organelle contact site functions. When designing experiments to study ATAD3, researchers should consider subcellular fractionation approaches that can effectively isolate MAM fractions where ATAD3A accumulates in disease states like Alzheimer's disease . Mitochondrial sub-compartmental fractionation techniques reveal ATAD3A enrichment in the same fractions as VDAC and SigmaR1, which are established MAM markers . For proximity-based interaction studies, in situ proximity ligation assay (PLA) has proven effective for assessing ATAD3A's association with other MAM components, as the physiological contact distance between ER and mitochondria (10-30 nm) makes this technique particularly suitable .

How do the functional domains of ATAD3 contribute to its biological activities?

ATAD3A belongs to the AAA-domain-containing ATPases superfamily, with its structure containing multiple functional domains that determine its diverse roles in mitochondrial biology . The protein contains two transmembrane domains that anchor it to the mitochondrial membranes, a coiled-coil domain that mediates protein-protein interactions, and an ATPase domain responsible for enzymatic activity . Interestingly, research has shown that ATAD3A oligomerization, which is enhanced in Alzheimer's disease models, appears to be independent of its ATPase activity . Experiments in 5XFAD mice demonstrated no change in ATAD3A ATPase activity compared to wildtype mice, and overexpression of an ATPase-dead mutant (ATAD3A-K358E-Flag) had no effect on ATAD3A oligomerization . This suggests that targeting protein-protein interactions rather than enzymatic activity may be more relevant for therapeutic approaches in certain disease contexts.

What is the composition of the ATAD3 gene cluster and how does it affect genetic studies?

The ATAD3 genomic locus presents unique challenges for genetic studies due to its location within a region of segmental duplications . The cluster consists of three genes: ATAD3A, ATAD3B, and ATAD3C . This genomic architecture creates regions with extended stretches of significant homology, with identity ranging from 93.5–99.3% over >950 bp between ATAD3C and ATAD3A . This high degree of similarity complicates genetic detection methods, as evidenced by the poor sensitivity of microarray platforms for CNV detection within this locus . Researchers should be aware that standard microarrays have limited probe coverage across the ATAD3 locus, making identification of ATAD3 copy number variations challenging . Alternative approaches such as whole genome sequencing, long-read DNA sequencing, and breakpoint PCR may be necessary for accurate genetic characterization .

How is ATAD3 dysregulated in neurodegenerative disease models?

In Alzheimer's disease (AD) experimental models, ATAD3A exhibits increased oligomerization that contributes to disease pathology . Studies have demonstrated that ATAD3A oligomers increase in immortalized mouse hippocampal HT-22 neurons and Neuro2a neuroblastoma cells exposed to oligomeric Aβ 1–42 peptide in a time- and dose-dependent manner . This phenomenon is also observed in primary cortical neurons treated with toxic Aβ and in stable APP wild-type and APP Swedish mutant-expressing Neuro2a cells, with greater increases in the APP Swedish mutant cells . Importantly, ATAD3A oligomers are elevated in specific brain regions of 5XFAD AD mice (cortex, hippocampus, and thalamus) that correspond to areas with Aβ aggregation and human APP expression . For researchers designing AD-related experiments, these regional specificity patterns should be considered when selecting tissue samples.

How do ATAD3 genetic alterations manifest in different experimental models?

Genetic alterations of ATAD3 produce distinct phenotypes depending on the nature of the mutation . Recessive deletions and dominant duplications in the ATAD3 locus cause lethal perinatal mitochondrial diseases characterized by pontocerebellar hypoplasia or cardiomyopathy, respectively . ATAD3 duplications (~68 Kb spanning ATAD3C, ATAD3B, and ATAD3A) result in a consistent clinical presentation of hypertrophic cardiomyopathy, hyperlactacidemia, and perinatal death, with corneal clouding, cataracts, encephalopathy, and white matter abnormalities also common . In contrast, heterozygous knockout of ATAD3A in AD mouse models (5XFAD het; CMV; ATAD3A fl/+) reduces ATAD3A oligomerization to levels observed in wildtype littermates without altering mitochondrial mass, as evidenced by unchanged levels of mitochondrial subcompartment proteins (VDAC, Tom20, ClpP, ATPB) . This suggests that genetic reduction of ATAD3A levels can mitigate pathological oligomerization without compromising baseline mitochondrial integrity.

How does ATAD3 regulate mitochondria-ER communication in health and disease?

ATAD3A plays a crucial role in maintaining the structural and functional integrity of mitochondria-ER contact sites . In Alzheimer's disease models, aberrant ATAD3A oligomerization at MAMs leads to hyperconnectivity between these organelles, as evidenced by increased proximity ligation assay (PLA) signal between SigmaR1 and VDAC . This disrupted mitochondria-ER communication impairs neuronal cholesterol turnover by inhibiting CYP46A1 gene expression . ATAD3A also regulates ER stress responses and cholesterol transport between these organelles . For researchers investigating organelle crosstalk, it's important to note that ATAD3A forms complexes with proteins located in both the mitochondrial membrane and ER, including mitochondrial fission protein dynamin-related protein 1 (DRP1), fusion proteins mitofusin-1 (MFN1) and MFN2, and CCDC56, a positive regulator of mitochondrial fission . These interactions position ATAD3A as a signaling node that integrates mitochondrial dynamics with inter-organelle communication.

What methodological approaches can detect ATAD3 oligomerization states?

Several complementary techniques have proven effective for detecting and quantifying ATAD3A oligomerization . Non-reducing SDS-PAGE (absence of β-mercaptoethanol) can reveal ATAD3A oligomers in protein lysates from cellular and tissue samples . Chemical cross-linking using bismaleimidohexane (BMH) has been successfully employed to stabilize and detect ATAD3A oligomeric complexes in cell culture models . Immunohistochemical analysis provides another approach, as higher ATAD3A immunodensity is observed in neurons from AD patients and mouse models compared to controls, reflecting increased oligomerization rather than changes in total protein or mRNA levels . For subcellular localization of oligomers, mitochondrial sub-compartmental fractionation combined with western blotting can determine the distribution of ATAD3A oligomers in different mitochondrial compartments, particularly the MAM fractions .

What experimental strategies can manipulate ATAD3 function in disease models?

Both genetic and pharmacological approaches have been developed to modulate ATAD3A function in disease models . Heterozygous knockout of ATAD3A (ATAD3A fl/+) using Cre-lox technology effectively reduces ATAD3A oligomerization in AD mouse models without altering mitochondrial mass . This genetic approach has been shown to enhance MAM integrity and cholesterol metabolism, suppress APP processing, mitigate synaptic loss, and ultimately reduce AD-associated neuropathology and cognitive deficits . Pharmacological inhibition of ATAD3A oligomerization represents another promising strategy, though specific compounds are not detailed in the provided search results . For researchers designing intervention studies, it's worth noting that complete knockout of ATAD3A is likely detrimental given its essential functions, while partial reduction appears to provide therapeutic benefits in disease contexts characterized by ATAD3A hyperactivity or oligomerization.

What are the challenges in detecting ATAD3 genetic variations in research specimens?

Detecting genetic variations in the ATAD3 locus presents significant technical challenges due to its location within segmental duplications . Standard microarray platforms show poor sensitivity for CNV detection within this region, and probe coverage across the ATAD3 locus is often limited . This was demonstrated in a clinical setting where an ATAD3 duplication was detected in only one of five confirmed ATAD3dup patients screened on the same array platform . For researchers investigating ATAD3 genetic variations, more sensitive techniques such as whole genome sequencing, long-read DNA sequencing, or targeted breakpoint PCR are recommended . When analyzing breakpoints, it's important to consider the high sequence homology between ATAD3 genes, with homology in regions upstream from breakpoints ranging from 93.5–99.3% identity over >950 bp in most cases . Population background should also be considered, as reference genomes may not accurately reflect all variation within this region in diverse ethnic groups .

How can interaction networks of ATAD3 be effectively analyzed?

To predict gene function and construct pathways for ATAD3 genes, researchers have employed bioinformatic tools such as the Database for Annotation, Visualization and Integrated Discovery (DAVID) to identify enriched Gene Ontology (GO) terms and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways . Network visualization software like Cytoscape 3.6.0 has been used to construct biological networks representing ATAD3 interactions . For experimental validation of protein interactions, proximity ligation assays (PLA) have proven effective for detecting ATAD3A's associations with other proteins at MAMs . Co-immunoprecipitation studies have identified ATAD3A interactions with mitochondrial dynamics proteins such as DRP1, MFN1, MFN2, and CCDC56 . When designing interaction studies, researchers should consider that ATAD3A forms complexes with proteins in both mitochondrial membranes and the ER, necessitating approaches that can detect interactions across these compartments.

How does ATAD3 influence cellular signaling networks beyond mitochondria?

ATAD3A extends its regulatory influence beyond mitochondrial functions to affect broader cellular signaling networks . Research has demonstrated that ATAD3A regulates the mammalian target of rapamycin (mTOR) pathway, sterol regulatory element binding protein 1c (SREBP-1c) signaling, and cyclin D1-dependent cell proliferation mechanisms . ATAD3A phosphorylation is modulated by insulin and serum factors, suggesting a role in metabolic signaling, though the specific serum components mediating this effect remain unidentified . In Alzheimer's disease contexts, ATAD3A oligomerization impacts APP processing through disruption of cholesterol metabolism, linking mitochondrial dysfunction to amyloid pathology . Future research could explore the reciprocal relationship between these signaling pathways and ATAD3A regulation, investigating whether targeting these pathways could indirectly modulate ATAD3A function in disease states.

What are the tissue-specific functions of ATAD3 in development and disease?

ATAD3 exhibits notable tissue-specific patterns in both expression and pathological consequences of its dysregulation . In Alzheimer's disease mouse models, ATAD3A oligomers are elevated specifically in the cortex, hippocampus, and thalamus, but not in other brain regions, corresponding to patterns of Aβ aggregation and human APP expression . ATAD3 duplications result in a distinct clinical presentation primarily affecting cardiac tissue (hypertrophic cardiomyopathy), with secondary involvement of the nervous system (encephalopathy, white matter abnormalities) . This contrasts with ATAD3 deletions, which predominantly manifest as severe pontocerebellar hypoplasia . In cancer research, ATAD3A and ATAD3B overexpression has been documented in hepatocellular carcinoma . These diverse tissue manifestations suggest context-dependent functions that may involve tissue-specific interaction partners or regulatory mechanisms. Future research could employ tissue-specific conditional knockout models to delineate the essential functions of ATAD3 across different organ systems during development and in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.