Recombinant Mouse Autophagy-related protein 9A (Atg9a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Autophagy-related Protein 9A (Atg9a)

Recombinant Mouse Autophagy-related Protein 9A (Atg9a) is a genetically engineered form of the transmembrane protein ATG9A, which is essential for autophagy—a lysosome-mediated degradation pathway critical for cellular homeostasis. ATG9A is the only multispanning membrane protein among core autophagy-related (ATG) proteins and plays roles in lipid mobilization, vesicle trafficking, and autophagosome formation . Recombinant Atg9a enables researchers to study its structure, interactions, and functional roles in vitro and in vivo.

Autophagy Regulation

Recombinant Atg9a is used to study:

  • Phagophore expansion: ATG9A vesicles deliver lipids to autophagosome precursors .

  • Lipid droplet dynamics: Depletion of ATG9A increases lipid droplet size/number, linking autophagy to lipid metabolism .

Cell Migration and Adhesion

  • β1 integrin trafficking: Recombinant Atg9a rescues integrin delivery to leading edges in migrating cells, enabling adhesion complex dynamics .

  • Lamellipodia formation: ATG9A vesicles promote actin-driven protrusions during chemotaxis .

Immune and Neuronal Functions

  • STING pathway regulation: Atg9a deficiency enhances dsDNA-induced interferon responses, implicating it in immune regulation .

  • Axon maintenance: Recombinant Atg9a restores neurite outgrowth in neurons, preventing degenerative lesions .

Table 2: Experimental Applications

ApplicationKey FindingsSource
Autophagy inhibition assaysRescue of LC3 lipidation and autophagosome formation in ATG9A-KO cells
Lipid droplet studiesATG9A depletion increases lipid storage in human cells and C. elegans
Neuronal degeneration modelsAxon-specific lesions in Atg9a-deficient mice reversed by recombinant protein
Immune signaling assaysEnhanced IFN-β production in Atg9a-KO MEFs

Table 3: Example Recombinant Atg9a Products

Product CodeSourceTagApplications
CSB-CF737885MOE. coliNoneFunctional assays, lipid studies
CSB-EP737885MO1Mammalian cellsMyc/DDKInteraction mapping, rescue experiments

Key Research Findings Using Recombinant Atg9a

  1. Lipid scrambling: ATG9A’s cytosolic platform domain enables phospholipid transfer between membrane leaflets, critical for autophagosome expansion .

  2. Disease links:

    • Cancer: ATG9A supports invasive glioma cell migration via integrin trafficking .

    • Neurodegeneration: Atg9a deficiency causes axon-specific degeneration and impaired neurite outgrowth .

  3. Immune modulation: Atg9a limits excessive STING-TBK1 signaling, preventing hyperactivation of interferon responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any special requirements for the format. Please specify your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Atg9a; Apg9l1; Autophagy-related protein 9A; APG9-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFT CMLIGEMFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQ VCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTW QEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEV VFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLL CPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKP ASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGVHLGGVAESHRHTPHSHLLPPPSGPG DHRLLPQLYGRGRGCGRHLLLCSDGRSPAWPSSVAVWRADRGLSVPASRGREDRVVAHAL CHHQSRLAAPS
Uniprot No.

Target Background

Function
Autophagy-related protein 9A (Atg9a) is a phospholipid scramblase integral to autophagy. Its primary function is to mediate autophagosomal membrane expansion. Atg9a cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool, supplying membrane for the growing autophagosome. Its lipid scramblase activity plays a crucial role in preautophagosomal structure/phagophore assembly by distributing phospholipids arriving through ATG2 (ATG2A or ATG2B) from the cytoplasmic to the luminal leaflet of the bilayer, driving autophagosomal membrane expansion. It is also required to supply phosphatidylinositol 4-phosphate to the autophagosome initiation site by recruiting phosphatidylinositol 4-kinase beta (PI4KB) in a process dependent on ARFIP2 but not ARFIP1. Beyond its role in autophagy, Atg9a also participates in necrotic cell death.
Gene References Into Functions
  1. Research indicates that Atg9a knockout mice exhibit abnormalities in bone surface formation, highlighting the crucial role of Atg9a-dependent necrosis in bone surface development. PMID: 27811852
  2. The AP-4 epsilon KO mouse model serves as a suitable representation of AP-4 deficiency syndrome. Defective mobilization of ATG9A from the TGN and impaired autophagic degradation of protein aggregates might contribute to neuroaxonal dystrophy in this disorder. PMID: 29698489
  3. Trafficking of Atg9A through recycling endosomes is an essential step in autophagosome formation. PMID: 27587839
  4. Atg9a(-/-) fetal mice from pregnant dams heterozygous for both knockout alleles of Atg9a and p57(Kip2) exhibit increased susceptibility to hypertensive stress compared to fetuses with intact autophagic machinery. PMID: 26370455
  5. Atg9a expression is essential for neural stem cell differentiation. PMID: 24973144
  6. Both AMPK and ULK1 regulate the localization of ATG9, a critical component of the phagophore. PMID: 22932492
  7. In the initial stages of Parkin-mediated mitophagy, structures containing the ULK1 complex and Atg9A are independently recruited to depolarized mitochondria. PMID: 22275429
  8. Atg9Ap may be involved in autophagosome formation in the ER and axon terminals of neurons, the TGN, and lysosomes/late endosomes. PMID: 20124090

Show More

Hide All

Database Links
Protein Families
ATG9 family
Subcellular Location
Preautophagosomal structure membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse Atg9a and how does it influence its function?

Mouse Atg9a is uniquely structured as a homotrimer, with each protomer comprising four transmembrane helices. High-resolution cryo-EM analysis reveals extensive domain swapping at the homotrimeric interface within the membrane region. The C-terminal domain forms an extended helical platform that serves as a crucial site for protein-protein interactions. Most distinctively, Atg9a contains an intricate network of branched cavities throughout the trimer structure, consistent with its proposed function as a lipid transport protein .

Functionally, molecular dynamics simulations demonstrate that Atg9a possesses membrane-bending properties, explaining its preferential localization to highly curved membranes within cells. The structural arrangement facilitates its role in membrane trafficking during autophagosome formation, allowing it to contribute to membrane curvature and lipid delivery at sites of phagophore formation .

How does Atg9a localization change during autophagy induction, and what techniques can effectively track these dynamics?

For tracking Atg9a dynamics, researchers can employ:

  • Immunofluorescence microscopy with co-localization analyses using markers for Golgi, endosomes, and forming autophagosomes

  • Live-cell imaging using GFP-tagged Atg9a to monitor real-time translocation

  • Immunoisolation of Atg9a-positive compartments followed by proteomic analysis to characterize composition changes during starvation

  • Super-resolution microscopy (such as STED) to visualize the distinct vesicle populations containing Atg9a

Quantitative analysis of Atg9a-positive compartments isolated from amino acid-starved cells demonstrates a depletion of Golgi proteins and enrichment in BAR-domain containing proteins, particularly Arfaptins, and phosphoinositide-metabolizing enzymes during autophagy induction .

What are the most effective methods for studying Atg9a-mediated lipid transport in autophagosome formation?

Investigating Atg9a-mediated lipid transport requires a multifaceted experimental approach:

  • Structural analysis of lipid-binding cavities:

    • High-resolution structural studies using cryo-EM to characterize the branched cavities within the Atg9a trimer

    • Site-directed mutagenesis of cavity-lining residues followed by functional assays to confirm the importance of these regions

    • Lipid binding assays with purified Atg9a to identify specific lipid preferences

  • Vesicle trafficking and composition analysis:

    • Immunoisolation of Atg9a-containing vesicles followed by lipidomic profiling

    • Pulse-chase experiments with fluorescently labeled lipids to track their delivery to forming autophagosomes

    • Super-resolution microscopy to visualize lipid transfer events at autophagosome formation sites

  • Functional reconstitution:

    • In vitro reconstitution of purified Atg9a in artificial membrane systems to directly observe lipid scramblase activity

    • Measurement of membrane curvature induction by Atg9a using giant unilamellar vesicles (GUVs)

Structure-function analyses using truncations and single amino-acid substitutions in Atg9a, followed by rescue experiments in Atg9a-knockout cells, have confirmed the importance of cavity-lining residues for proper autophagy function. These studies show that Atg9a-knockout cells exhibit large cytoplasmic puncta of aberrant autophagosomes decorated with LC3B, approximately 40% larger than those in wild-type cells .

How can researchers effectively generate and characterize Atg9a knockout models to study its function?

Generation and characterization of Atg9a knockout models require careful consideration of several methodological aspects:

Generation approaches:

  • CRISPR/Cas9-mediated deletion in cell lines:

    • Target conserved exons (particularly exons 6-11 which are critical for function)

    • Confirm deletion by genomic PCR, Western blotting, and mRNA analysis

    • Consider creating conditional knockouts due to potential lethality

  • Mouse embryonic fibroblast (MEF) isolation from Atg9a-deficient embryos:

    • Since Atg9a-knockout mice die within one day of delivery, MEFs must be isolated from embryos before birth

    • Genotype embryos to identify knockouts

    • Establish and immortalize MEF lines for sustained experimentation

Characterization approaches:

In published research, Atg9a-knockout MEFs show impaired LC3 conjugation to phosphatidylethanolamine (PE), decreased formation of LC3 dots and autophagosomes under starvation conditions, reduced bulk degradation of long-lived proteins, and massive accumulation of p62, confirming Atg9a's essential role in autophagy .

How does Atg9a interact with other autophagy-related proteins to facilitate autophagosome formation?

Atg9a engages in multiple protein-protein interactions that are critical for autophagosome biogenesis:

Interacting PartnerInteraction Site on Atg9aFunctional Consequence
ATG2AC-terminal domainFacilitates lipid transfer between membranes
PI4KIIIβTransmembrane regionsControls PI4P production at initiation membrane sites
ATG13Unknown (indirect via PI4KIIIβ)Recruits ULK1/2 initiation complex to nascent autophagosomes
STINGUnknownRegulates dsDNA-induced innate immune responses
LC3UnknownCo-localizes after sensing dsDNA

The folded portion of the C-terminal domain of Atg9a is particularly crucial for interactions with ATG2A, as demonstrated by functional experiments. These interactions are essential for proper autophagosome formation, as disruption leads to abnormal autophagosome morphology .

During autophagy induction, Atg9a vesicles deliver PI4-kinase (PI4KIIIβ) to autophagosome initiation sites. PI4KIIIβ then interacts with both Atg9a and ATG13 to control PI4P production at these sites, which serves as a critical signal for recruiting other autophagy-related proteins and supporting the autophagic response .

What is the role of Atg9a in the regulation of dsDNA-induced innate immune responses?

Atg9a plays a crucial regulatory role in dsDNA-induced innate immune signaling through the following mechanisms:

  • Regulation of STING trafficking and assembly:

    • While dsDNA-induced translocation of STING from the ER to the Golgi apparatus occurs normally in Atg9a-knockout MEFs, subsequent translocation of STING from the Golgi to punctate structures is significantly enhanced

    • The assembly of STING with TBK1 (TANK-binding kinase 1) is greatly enhanced in Atg9a-knockout cells

    • This suggests Atg9a normally acts as a limiting factor in this process

  • Control of downstream signaling:

    • Atg9a-knockout MEFs exhibit enhanced dsDNA-induced phosphorylation of IRF3

    • Transcription of Interferon-β (Ifn-β), Interleukin-6 (Il-6), and Cxcl10 is significantly upregulated in Atg9a-knockout cells

    • Production of IFN-β is enhanced in Atg9a-knockout MEFs but returns to normal levels when these cells are reconstituted with Atg9a-GFP

Experimental data demonstrates that dsDNA-induced STING-positive puncta do not have the characteristic double-membrane structure of autophagosomes but rather represent unidentified membrane-bound compartments. This suggests Atg9a's role in immune regulation may be partially independent of its canonical autophagy function .

How does Atg9a function in neuronal cells, and what specialized methods are required to study it in this context?

In neuronal cells, Atg9a displays several unique characteristics and functions:

  • Distinct localization pattern:

    • Atg9a-containing vesicles are particularly enriched in synapses

    • These vesicles closely resemble synaptic vesicles in both size and density

    • They represent a distinct vesicle population with limited overlap with synaptic vesicles and other secretory pathway membranes

  • Specialized function in axonal autophagy:

    • Autophagosome biogenesis primarily occurs in distal axons

    • Autophagosomal growth depends on membrane lipid supply via Atg9a-containing vesicles

    • Atg9a vesicles likely function as lipid shuttles that scavenge membrane lipids from various intracellular membranes to support autophagosome biogenesis

Specialized methods for studying neuronal Atg9a include:

  • Advanced imaging techniques:

    • Super-resolution microscopy approaches including DNA-PAINT, DyMIN STED, and Minflux

    • Live imaging of Atg9a trafficking in axons using microfluidic chambers to separate axons from cell bodies

  • Proteomics analysis:

    • Immunoisolation of Atg9a-containing vesicles from neuronal preparations

    • Mass spectrometry with intensity-based absolute quantification (iBAQ)

    • Comparative analysis with other vesicle populations

Proteomic analysis of Atg9a-containing vesicles from nerve terminals reveals conspicuously low levels of trafficking proteins, with the exception of the AP2-complex and certain enzymes involved in endosomal phosphatidylinositol metabolism. This unique proteome profile supports the specialized role of these vesicles in lipid transport rather than conventional membrane trafficking .

What phenotypes are observed in tissue-specific Atg9a knockout models?

Tissue-specific phenotypes of Atg9a deficiency provide important insights into its differential functions:

  • Systemic knockout consequences:

    • Complete Atg9a knockout is lethal, with mice dying within one day after birth

    • This phenotype resembles that observed in Atg5-, Atg7-, and Atg16L1-deficient mice

    • The lethality is likely related to the inability to survive neonatal starvation due to defective autophagy

  • Cellular phenotypes:

    • Fibroblasts: Atg9a-knockout MEFs show impaired autophagosome formation, defective LC3 lipidation, accumulation of p62, and decreased degradation of long-lived proteins

    • Immune cells: Enhanced dsDNA-induced innate immune responses, increased production of inflammatory cytokines

    • Neurons: Abnormal accumulation of protein aggregates, altered synaptic vesicle dynamics

For experimental analysis of tissue-specific functions, researchers should consider:

  • Creating conditional knockout models using tissue-specific Cre recombinase expression

  • Performing rescue experiments with tissue-specific promoters

  • Employing tissue-specific isolation techniques for Atg9a-containing vesicles

  • Using electron microscopy to characterize ultrastructural changes in different tissues

These approaches can help elucidate the tissue-specific requirements for Atg9a and may reveal novel therapeutic targets for diseases involving autophagy dysregulation, particularly neurodegenerative diseases where protein aggregation plays a central role .

How can structure-based design be used to develop tools for studying Atg9a function?

Structure-based approaches offer powerful opportunities for developing research tools to probe Atg9a function:

  • Domain-specific antibodies and nanobodies:

    • Design antibodies targeting exposed epitopes identified in the high-resolution structure

    • Develop conformation-specific antibodies that recognize active versus inactive states

    • Create nanobodies that bind but don't interfere with function for tracking studies

  • Rationally designed mutants:

    • Engineer cavity-lining mutations to alter lipid transport capabilities

    • Create interface mutations to destabilize or enhance trimerization

    • Design C-terminal domain variants with altered protein interaction properties

  • Small molecule modulators:

    • Identify binding pockets within the branched cavity network

    • Design small molecules that can specifically bind these pockets

    • Develop inhibitors or activators of Atg9a function for acute manipulation

  • Genetically encoded biosensors:

    • Create FRET-based sensors that report on Atg9a conformational changes

    • Develop split fluorescent protein systems to monitor protein-protein interactions

    • Design biosensors that detect Atg9a-mediated lipid transfer events

These structure-based tools would significantly enhance our ability to dissect the precise molecular mechanisms of Atg9a function in autophagy and immune regulation, moving beyond correlation to direct causal relationships .

What are the methodological challenges in studying the interplay between Atg9a and other membrane trafficking pathways?

Investigating the complex relationship between Atg9a and membrane trafficking pathways presents several significant methodological challenges:

  • Temporal resolution limitations:

    • Atg9a trafficking events occur rapidly, requiring high-speed imaging techniques

    • Synchronizing autophagy induction across cell populations is difficult

    • Capturing transient interactions between Atg9a vesicles and donor membranes requires specialized approaches

  • Spatial resolution constraints:

    • Distinguishing between different vesicle populations requires super-resolution microscopy

    • Identifying the precise membrane origin of Atg9a vesicles is challenging

    • Monitoring lipid transfer events between closely apposed membranes is technically difficult

  • Biochemical separation challenges:

    • Isolating pure populations of Atg9a vesicles without contamination

    • Maintaining vesicle integrity during isolation procedures

    • Distinguishing between direct Atg9a interactions and co-localization in membrane microdomains

  • Experimental approach recommendations:

    • Combine complementary techniques (imaging, biochemistry, genetics)

    • Utilize correlative light and electron microscopy (CLEM) to connect functional observations with ultrastructural details

    • Employ proximity labeling methods (BioID, APEX) to identify transient interaction partners

    • Develop in vitro reconstitution systems with defined membrane compositions

Understanding the heterogeneity in membrane composition of Atg9a-containing vesicles is particularly challenging but critical, as research indicates these vesicles may function as lipid shuttles that scavenge membrane lipids from various intracellular sources to support autophagosome biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.