Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bcap31; Bap31; B-cell receptor-associated protein 31; BCR-associated protein 31; p28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-245
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVL LVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGLSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENK SLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSV KKEE
Uniprot No.

Target Background

Function

B-cell receptor-associated protein 31 (BAP31) functions as a chaperone protein and is one of the most abundant proteins within the endoplasmic reticulum (ER). It plays a crucial role in the export of secreted proteins from the ER, recognizing misfolded proteins and targeting them for ER-associated degradation (ERAD). Additionally, it acts as a cargo receptor for transmembrane protein export. BAP31 is also involved in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by facilitating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria through interaction with TOMM40. In response to ER stress, BAP31 relocates from ER-mitochondria contact sites and binds BCL2. It may also participate in CASP8-mediated apoptosis.

Gene References Into Functions
  1. BAP31 plays a significant role in T cell activation by regulating TCR signaling. PMID: 28333124
  2. The C-terminal domain of BAP31 is surface-exposed on mouse embryonic stem cells. PMID: 26102500
  3. BAP31/CDIP1 regulates the mitochondrial apoptosis pathway, establishing ER-mitochondrial crosstalk for ER-stress-mediated apoptosis. PMID: 24139803
  4. ER-localized Bcl2 protects against a Bax/Bak-independent cell death pathway initiated by the p20 fragment of Bap31. PMID: 22197342
  5. A high-molecular-weight complex of membrane proteins BAP29/BAP31 retains membrane-bound IgD in the ER. PMID: 12886015
  6. Bap29/31 recruits class I molecules to ER exit sites and acts as a cargo receptor for MHC class I molecules. PMID: 15187134
  7. p20 BAP31 influences cell surface properties by affecting protein egress from the ER, potentially upstream of BCL-2. PMID: 15946936
  8. Changes in AMPA receptor composition (increased GluR1) and upregulation of the Bap31 gene may contribute to fatigue in mice. PMID: 16051435
  9. Interaction between P450 2C2 and BAP31 is crucial for ER retention and expression levels of P450 2C2; BAP31 may regulate apoptosis induced by ER overload. PMID: 16332681
Database Links

KEGG: mmu:27061

STRING: 10090.ENSMUSP00000002091

UniGene: Mm.17

Protein Families
BCAP29/BCAP31 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the biological function of BCAP31?

BCAP31 functions primarily as a chaperone protein and is one of the most abundant endoplasmic reticulum (ER) proteins. It plays critical roles in:

  • Facilitating the export of secreted proteins from the ER to the Golgi apparatus

  • Recognizing abnormally folded proteins and targeting them for ER-associated degradation (ERAD)

  • Serving as a cargo receptor for transmembrane protein export

  • Potentially mediating CASP8-associated apoptotic pathways

The protein forms homodimers and heterodimers with BCAP29 and interacts with multiple binding partners including CASP8, VAMP3, VAMP1, and membrane IgD immunoglobulins. These interactions are essential for its diverse cellular functions in protein trafficking and quality control .

What is the structural organization of BCAP31?

BCAP31 is a multi-pass membrane protein with a specific structural organization:

  • N-terminus located in the ER lumen

  • Three transmembrane domains that anchor the protein to the ER membrane

  • C-terminus positioned in the cytoplasm, mediating protein-protein interactions

This structural arrangement is critical for its function, with the C-terminal domain primarily responsible for its protein transport and apoptosis regulation activities . The protein shuttles between the ER and the intermediate compartment/cis-Golgi complex, enabling its transport functions .

How is BCAP31 detected in mouse tissues and cell cultures?

BCAP31 detection in mouse samples typically employs ELISA-based methods or immunoblotting techniques. For ELISA detection:

  • Sandwich ELISA techniques provide high sensitivity (approximately 0.078 ng/mL) and a detection range of 0.156-10 ng/mL

  • Mouse BCAP31 can be detected in serum, plasma, tissue homogenates, and cell culture supernatants

  • Sample preparation should involve careful optimization of dilution factors based on expected protein concentration

For immunohistochemical detection, anti-BAP31 antibodies (such as ab237485) can be used with appropriate secondary antibody systems and 3,3-diaminobenzidin for visualization. Counterstaining with hematoxylin provides cellular context .

What are the clinical implications of BCAP31 expression?

BCAP31 expression has significant clinical implications, particularly in cancer research:

  • Upregulated expression in various cancer types including malignant melanoma, hepatocellular carcinoma, cervical cancer, and ovarian cancer compared to normal tissues

  • In ovarian cancer, higher expression correlates with increased proliferation, invasion, and migration

  • May serve as a potential biomarker for certain cancer types

  • Could represent a therapeutic target, particularly for immunotherapy approaches in malignant melanoma

Interestingly, in colorectal cancer, BCAP31 expression positively correlates with liver metastasis, yet patients with lower BCAP31 expression show significantly decreased survival rates, suggesting context-dependent functions .

How does BCAP31 influence epithelial-mesenchymal transition in cancer cells?

BCAP31 regulates epithelial-mesenchymal transition (EMT) through a transcriptional mechanism involving TWIST1:

  • BCAP31 controls the nuclear aggregation of TWIST1, a transcriptional regulator

  • TWIST1 directly regulates the expression of EMT markers N-cadherin and E-cadherin

  • BCAP31 knockdown results in downregulation of N-cadherin and upregulation of E-cadherin

  • This regulation occurs at the transcriptional level rather than through direct protein-protein interactions

  • When TWIST1 is overexpressed in BCAP31 knockdown cells, E-cadherin and N-cadherin expression levels are restored to normal

This mechanism explains how BCAP31 contributes to cancer cell migration and invasion capabilities, suggesting that targeting this pathway could have therapeutic potential in cancer treatment.

What is the relationship between BCAP31 and apoptosis regulation?

BCAP31 serves a dual role in cellular function, with apoptosis regulation being a critical aspect:

  • BCAP31 is involved in regulating apoptosis mediated by Bcl-2 and Bcl-XL

  • It functions within a protein complex containing BCAP31, BCAP29, BCL2, and/or BCL2L1

  • This complex interacts with CASP8, a key initiator caspase in the apoptotic cascade

  • The C-terminal domain of BCAP31 is particularly important for its apoptosis regulation function

Researchers investigating apoptotic pathways should consider BCAP31 as a potential modulator of cell death decisions, particularly in cancer contexts where apoptosis evasion is a hallmark.

How do post-translational modifications affect BCAP31 function?

While the search results don't directly address post-translational modifications of BCAP31, this represents an important research question. Based on protein biology principles:

  • Potential phosphorylation sites on the cytoplasmic C-terminal domain may regulate interaction with binding partners

  • Ubiquitination could influence BCAP31 stability and turnover

  • Glycosylation of the N-terminal domain might affect protein folding and quality control

  • Other modifications could alter subcellular localization and trafficking between ER and Golgi

Methodological approaches to study these modifications would include mass spectrometry, site-directed mutagenesis of putative modification sites, and specific antibodies against modified forms of the protein.

What are the optimal approaches for BCAP31 knockdown studies?

BCAP31 knockdown can be achieved using several complementary approaches:

  • shRNA-mediated knockdown:

    • Utilize lentiviral transduction particles targeting BCAP31

    • Recommended shRNA sequences:

      • 5'-CCGGCATGGACAAGAAGGAAGAGTACTCGAGTACTCTTCCTTCTTGTCCATGTTTTTTG-3'

      • 5'-CCGGCCTATGGCAACACCTTCTTTGCTCGAGCAAAGAAGGTGTTGCCATAGGTTTTTG-3'

    • Include appropriate negative control shRNA that doesn't target any known genes

  • siRNA-mediated knockdown:

    • Use commercial siRNAs (e.g., siRNA ID 138059)

    • Transfect at 50 nmol/l concentration using Lipofectamine 3000 reagent

    • Harvest cells at 48 hours post-transfection for analysis

  • CRISPR-Cas9 gene editing:

    • Design guide RNAs targeting exons of BCAP31

    • Select and validate knockout clones by Western blotting and sequencing

Validation of knockdown efficiency should be performed at both mRNA (RT-qPCR) and protein (Western blot) levels before conducting functional assays.

How can BCAP31 protein-protein interactions be effectively studied?

Investigating BCAP31 protein-protein interactions requires multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-BCAP31 antibodies to pull down protein complexes

    • Analyze by Western blotting for potential interaction partners (BCAP29, TWIST1, etc.)

    • Include appropriate negative controls (IgG of the same species)

  • Proximity ligation assays:

    • Detect protein interactions in situ within cells

    • Provides spatial information about where interactions occur

  • Yeast two-hybrid screening:

    • Identify novel interaction partners

    • Use the C-terminal domain as bait for screening

  • Mass spectrometry-based approaches:

    • Provide unbiased identification of interaction partners

    • Require careful optimization of immunoprecipitation conditions

These methods should be used in combination for robust verification of protein interactions.

What considerations are important when expressing recombinant mouse BCAP31?

Expression of recombinant mouse BCAP31 requires careful consideration of several factors:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) provide proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) offer higher yields with eukaryotic processing

    • Bacterial systems may be used for specific domains but risk improper folding of the full-length protein

  • Construct design:

    • Include appropriate affinity tags (His, FLAG, GST) for purification

    • Consider the position of tags to avoid interference with function

    • Include TEV or other protease cleavage sites for tag removal if necessary

  • Purification strategy:

    • For membrane proteins like BCAP31, detergent selection is critical

    • Use mild detergents (DDM, LMNG) for initial extraction

    • Consider nanodiscs or amphipols for stabilization

  • Functional validation:

    • Verify proper folding and activity through functional assays

    • Confirm interactions with known binding partners

How should researchers interpret conflicting BCAP31 expression data across different cancer types?

When confronted with apparently contradictory BCAP31 expression data:

  • Context-specific evaluation:

    • In most cancers, BCAP31 expression is elevated compared to normal tissues

    • In colorectal cancer, higher expression correlates with liver metastasis, but lower expression correlates with poorer survival

  • Methodological considerations:

    • Verify antibody specificity using multiple independent antibodies

    • Distinguish between mRNA and protein expression levels

    • Consider tissue heterogeneity and the specific cell types examined

  • Functional validation:

    • Perform knockdown/overexpression studies in multiple cell lines

    • Examine effects on relevant cancer hallmarks (proliferation, migration, apoptosis)

    • Correlate with clinical outcomes in patient cohorts

  • Molecular context analysis:

    • Examine expression of interacting partners (BCAP29, TWIST1)

    • Consider pathway activation states that might modify BCAP31 function

    • Evaluate splice variants that could have altered function

What statistical approaches are most appropriate for analyzing BCAP31 ELISA data?

For rigorous analysis of BCAP31 ELISA data:

  • Standard curve optimization:

    • Use 4-parameter logistic regression for standard curve fitting

    • Ensure R² > 0.98 for reliable quantification

    • Include quality control samples of known concentration

  • Sample analysis:

    • Run all samples in triplicate

    • Calculate mean, standard deviation, and coefficient of variation

    • Flag and investigate samples with CV > 15%

  • Appropriate statistical tests:

    • For comparing two groups: t-test (parametric) or Mann-Whitney (non-parametric)

    • For multiple groups: ANOVA with appropriate post-hoc tests

    • For correlations with other parameters: Pearson or Spearman correlation coefficients

  • Data reporting:

    • Include measures of central tendency and dispersion

    • Report exact p-values and confidence intervals

    • Present data in graphical format with appropriate error bars

Statistical ParameterThreshold for AcceptanceImplications if Not Met
Standard Curve R²> 0.98Unreliable quantification
Intra-Assay CV< 10%Poor technical replication
Inter-Assay CV< 15%Poor assay reproducibility
Sample ParallelismDilution curves parallel to standardMatrix interference
Recovery80-120%Sample matrix effects

How can researchers distinguish between direct and indirect effects of BCAP31 in experimental systems?

Distinguishing direct from indirect effects requires careful experimental design:

  • Temporal analysis:

    • Track changes in multiple parameters over time after BCAP31 manipulation

    • Direct effects typically manifest earlier than indirect effects

  • Rescue experiments:

    • Re-express wild-type or mutant BCAP31 in knockdown cells

    • Determine which phenotypes are rescued and which are not

  • Domain-specific mutants:

    • Create mutants affecting specific domains or functions

    • Analyze which phenotypes are affected by each mutation type

  • Interaction studies:

    • Perform Co-IP followed by Western blotting for suspected direct targets

    • Negative results suggest indirect regulation

  • Transcriptional analysis:

    • Compare immediate early gene changes versus late changes

    • Use transcription inhibitors to block secondary gene expression changes

What are the future research directions for BCAP31 in immune modulation?

BCAP31 research in immune modulation presents several promising directions:

  • B-cell receptor signaling pathway analysis:

    • Map the precise role of BCAP31 in BCR signal transduction

    • Identify phosphorylation events and kinase interactions

    • Determine how BCAP31 influences B-cell activation thresholds

  • Therapeutic targeting potential:

    • Develop small molecule inhibitors of BCAP31-protein interactions

    • Explore antibody-based approaches to modulate BCAP31 function

    • Assess effects on autoimmune disease models

  • Immune cell trafficking:

    • Investigate BCAP31's role in plasma cell development and antibody secretion

    • Examine effects on memory B-cell formation and function

    • Study interactions with cytoskeletal components in immune synapse formation

  • Cross-talk with other immune pathways:

    • Explore interactions with T-cell activation pathways

    • Investigate role in antigen presentation processes

    • Determine effects on cytokine production and receptor trafficking

These research directions will help establish the full significance of BCAP31 in immune regulation and potentially identify novel therapeutic approaches for immune-related disorders.

How might BCAP31 research contribute to cancer therapeutics development?

BCAP31 research has significant potential for cancer therapeutic development:

  • Targeted therapy approaches:

    • Develop inhibitors of BCAP31-TWIST1 interaction to block EMT

    • Create peptide mimetics that interfere with BCAP31's role in protein trafficking

    • Design antibody-drug conjugates targeting BCAP31-expressing cancer cells

  • Biomarker development:

    • Establish BCAP31 expression profiles across cancer types

    • Correlate expression with response to existing therapies

    • Develop companion diagnostics for BCAP31-targeted treatments

  • Combination therapy strategies:

    • Identify synergistic effects between BCAP31 inhibition and standard treatments

    • Explore synthetic lethality approaches with other genetic alterations

    • Investigate immunotherapy combinations based on BCAP31's immune functions

  • Resistance mechanism elucidation:

    • Study how cancer cells adapt to BCAP31 inhibition

    • Identify bypass pathways that may emerge

    • Develop strategies to prevent or overcome resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.