Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLG GLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFA AISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSI QSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEI IELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Uniprot No.

Target Background

Function

Function: CD20 is a B-lymphocyte-specific membrane protein crucial for regulating cellular calcium influx. This process is essential for B-lymphocyte development, differentiation, and activation. It functions as a store-operated calcium (SOC) channel component, facilitating calcium influx following B-cell receptor (BCR) activation.

Gene References Into Functions

Related Research: The following publications highlight the role of CD20 in various biological processes:

  1. Anti-CD20-IFNα eradicates B-cell lymphoma by utilizing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8+ T cells, synergizing with anti-PD-L1 treatment. PMID: 28533311
  2. Galectin-1 contributes to lymphoma CD20 immunotherapy resistance in a mouse model. PMID: 26888257
  3. An antigen-specific B cell response to intracellular pathogens is generated during anti-CD20 depletion therapy. PMID: 26261496
  4. CD20 plays a role in B cell activation and T-dependent humoral immunity. PMID: 23966626
  5. CD20 is necessary for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
  6. Immunization with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants significantly depletes splenic B cells in vivo. PMID: 20189250
  7. Type I CD20 antibody cytotoxicity depends critically on Fc receptor ITAM signaling. PMID: 20354182
  8. CD20 deficiency impairs T cell-independent antibody responses in humans. PMID: 20038800
  9. Review of CD20 structure, function, tissue, and cell distribution. PMID: 12144126
  10. Anti-CD20 antibodies rapidly deplete circulating and tissue B cells in an isotype-restricted manner, dependent on effector cell Fc receptor expression. PMID: 15210744
  11. Expression in bacterial cells; isolation and biophysical and structural studies. PMID: 16285718
  12. Anti-CD20 mAb treatment significantly reduces arthritis development in mice compared to control mAb-treated mice. PMID: 18354225
  13. CD20's involvement in calcium influx. PMID: 18474602
Database Links

KEGG: mmu:12482

STRING: 10090.ENSMUSP00000126422

UniGene: Mm.4046

Protein Families
MS4A family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.

Q&A

What is Mouse B-lymphocyte antigen CD20 (Ms4a1) and what is its significance in immunology?

Mouse B-lymphocyte antigen CD20, also known as Ms4a1, Ly-44, or Ms4a2, is a 297 amino acid non-glycosylated type III membrane protein that belongs to the MS4A tetraspanin protein family . It is expressed on pre-B cells, naïve and mature B lymphocytes, and B-cell lymphomas . The protein's significance in immunology stems from its role in B cell development, activation, and function.

CD20 is particularly important because it plays a role in the regulation of ion influx in B cells, which affects various cellular processes including activation, proliferation, and differentiation . For researchers, studying CD20 is valuable because it serves as an important B cell marker and potential therapeutic target in various B cell-mediated conditions, including autoimmune diseases and B cell malignancies.

Methodologically, when working with recombinant mouse CD20, researchers should consider using flow cytometry with specific anti-CD20 antibodies for detection and characterization of B cell populations, as this approach allows for precise identification of CD20-expressing cells within heterogeneous samples .

How does recombinant Mouse CD20 differ from native CD20 in experimental applications?

Recombinant Mouse CD20 is produced in expression systems (typically yeast, as indicated in the search results) and often includes additional structural elements to facilitate purification and experimental manipulation . The recombinant version frequently contains tags such as the N-terminal 6xHis-tag, which ensures efficient purification and robust stability .

When designing experiments, researchers should consider that:

  • The recombinant protein may represent only a partial sequence of the native protein. For example, the product referenced in the search results exhibits a partial protein length (111-291aa) .

  • The presence of tags might influence protein folding, activity, or interactions. The N-terminal 6xHis-tag will affect the protein's N-terminus and potentially its interactions with other molecules .

  • Expression in non-mammalian systems (like yeast) means the protein may lack mammalian-specific post-translational modifications that might be important for certain functions.

For optimal results, researchers should consider whether these differences impact their specific experimental questions. When studying interactions with natural binding partners or conformational epitopes, it may be necessary to either remove the tag after purification or validate that the tag doesn't interfere with the biological activity under investigation.

What are the optimal methods for detecting CD20 expression in mouse models?

The detection of CD20 expression in mouse models can be accomplished through several complementary techniques, each with specific advantages depending on the research question:

  • Flow Cytometry: This is the gold standard for quantitative analysis of CD20 expression at the cellular level. Antibodies such as Mouse Anti-Human MS4A1/CD20 have been validated for flow cytometry, allowing researchers to simultaneously analyze CD20 expression alongside other markers like CD19 . When implementing this approach, researchers should include appropriate isotype controls (e.g., Mouse IgG1) to determine specific binding and use secondary antibodies like anti-Mouse IgG APC-conjugated Secondary Antibody for detection .

  • Immunohistochemistry (IHC)/Immunofluorescence (IF): These techniques allow for visualization of CD20 expression in tissue context, preserving spatial information. The search results indicate successful implementation using antibodies at concentrations of approximately 15 μg/mL with incubation for 1 hour at room temperature . Detection systems like Anti-Mouse IgG VisUCyte HRP Polymer Antibody with DAB staining have proven effective .

  • Western Blotting: For protein level analysis, western blotting using anti-B-lymphocyte antigen CD20 antibodies can detect CD20 in mouse samples . This technique is particularly useful for quantifying total protein expression rather than cell surface expression.

When designing multi-parameter analysis, researchers should consider that CD20 expression varies during B cell development and between different B cell subpopulations. Co-staining with markers like CD79A can help differentiate between naive-like B cells (CD20+CD79A+) and other B cell populations .

How does CD20 expression correlate with tumor progression in cancer models?

CD20 expression has shown significant correlations with tumor progression, particularly in Non-Small Cell Lung Cancer (NSCLC) models. Research indicates that CD20-expressing B cells may play a tumor-suppressive role in certain cancer contexts .

Single-cell RNA sequencing and immunohistochemical analyses have revealed:

For researchers studying CD20 in tumor models, it is advisable to employ multi-parameter approaches that distinguish between different B cell populations (e.g., naive-like B cells versus plasma-like B cells) as they may have distinct functional roles in the tumor microenvironment. Flow cytometry panels should include CD20 alongside other markers like CD79A to accurately identify these subpopulations .

What are the optimal conditions for the recombinant expression of Mouse CD20?

Optimizing recombinant expression of Mouse CD20 requires careful consideration of several factors to ensure proper protein folding, stability, and functionality. Based on available information, the following methodological approaches are recommended:

  • Expression System Selection: Yeast expression systems have proven effective for recombinant production of Mouse CD20 (Ms4a1) . This system offers advantages for membrane proteins due to its eukaryotic protein processing capabilities while being more economical than mammalian systems.

  • Protein Construct Design:

    • Consider expressing partial protein length (e.g., 111-291aa as mentioned in the search results) rather than the full-length protein, particularly if specific domains are of interest

    • Include purification tags, such as the N-terminal 6xHis-tag, for efficient purification

    • The sequence structure should be carefully designed - for example: EAEAYVHHHHHHEFRT + protein sequence

  • Purification Strategy:

    • Implement affinity chromatography using the 6xHis-tag for primary purification

    • Follow with size exclusion chromatography to achieve high purity (>90% as verified by SDS-PAGE)

  • Final Formulation Options:

    • Consider both liquid formulation and lyophilized powder options depending on research needs and stability requirements

    • For long-term storage, lyophilized preparations are generally more stable

  • Quality Control:

    • Verify protein purity by SDS-PAGE (aim for >90% purity)

    • Confirm identity and integrity through mass spectrometry

    • Validate functionality through binding assays with known interaction partners

When optimizing expression conditions, researchers should systematically vary parameters such as temperature, induction time, and media composition to maximize yield while maintaining proper folding and functionality of the membrane protein.

How do B cell subpopulations expressing different levels of CD20 differ functionally in immune responses?

B cell subpopulations expressing different levels of CD20 demonstrate distinct functional characteristics in immune responses. Single-cell transcriptome analysis has revealed important functional differences between CD20-expressing naive-like B cells and other B cell populations:

  • Naive-like B Cells (CD20+/MS4A1+):

    • Express markers including MS4A1 (CD20), CD19, CD22, TCL1A, and CD83

    • Primarily localized in tertiary lymphoid structures (TLS) in tumor tissues

    • Associated with favorable prognosis in cancer models like NSCLC

    • Gene expression profile in tumor microenvironment includes upregulation of RACK1, JUND, CD83, ELOB, NFKB1A, APOE, and GADD45B compared to peripheral blood CD20+ B cells

    • Function in anti-tumor immune responses, with culture supernatants from CD20+ B cells demonstrating suppressive effects on lung cancer cell lines (A549 and H1299)

  • Plasma-like B Cells (CD79A+/CD20-):

    • Express markers such as CD38, TNFRSF17 (BCMA), and IGHG1/IGHG4

    • Distributed both within TLS and randomly throughout tumor tissues

    • Have different functional properties compared to naive-like B cells

These B cell populations establish distinct cell-cell interaction networks within the immune microenvironment. Analysis using the CellPhoneDB algorithm has demonstrated that CD20+ B cells engage in significant interactions with other immune cell types, suggesting an essential role in coordinating immune responses .

Methodologically, researchers investigating these B cell subsets should employ:

  • Multi-parameter flow cytometry combining CD20 with CD79A and other markers like CD19, CD38, and CD138

  • Single-cell RNA sequencing to comprehensively profile gene expression differences

  • Cell sorting of distinct populations followed by functional assays to directly compare their effector functions

  • Co-culture experiments with other immune cells to assess regulatory interactions

Understanding these functional differences is crucial for developing targeted immunotherapies and interpreting B cell infiltration patterns in disease contexts.

What methodological approaches are recommended for studying CD20's role in B cell signaling?

Studying CD20's role in B cell signaling requires sophisticated methodological approaches that can capture its involvement in membrane organization and ion flux regulation. Based on current understanding of CD20 biology, the following experimental strategies are recommended:

  • Lipid Raft Association Studies:

    • Since CD20 associates with lipid rafts upon crosslinking , detergent-resistant membrane fractionation can be used to isolate lipid raft components

    • Density gradient ultracentrifugation followed by western blotting for CD20 and known raft markers can identify translocation patterns

    • Fluorescence microscopy using cholesterol-binding probes (e.g., filipin) alongside CD20 immunostaining can visualize spatial association in intact cells

  • Ion Channel Measurements:

    • Patch-clamp electrophysiology to measure ion currents in CD20-expressing vs. CD20-knockout B cells

    • Calcium imaging using ratiometric dyes (Fura-2) or genetically encoded calcium indicators to monitor calcium flux following B cell receptor activation in the presence/absence of CD20

    • Pharmacological manipulation using ion channel blockers to identify which channels might be regulated by CD20

  • Signaling Pathway Analysis:

    • Phospho-specific flow cytometry to simultaneously measure multiple signaling proteins (e.g., phospho-ERK, phospho-AKT) at the single-cell level following B cell activation

    • Proximity ligation assays to detect protein-protein interactions between CD20 and potential signaling partners

    • CRISPR-Cas9 gene editing to create CD20 mutants with altered signaling properties

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize nanoscale organization of CD20 in the plasma membrane

    • Single-particle tracking to monitor CD20 mobility and clustering dynamics in living B cells

    • FRET (Förster Resonance Energy Transfer) to detect molecular proximity between CD20 and other signaling molecules

  • Systems Biology Approaches:

    • Proteomics analysis of CD20 interactome under different activation conditions

    • Transcriptomics to identify gene expression changes in CD20-deficient versus wild-type B cells

    • Computational modeling of B cell signaling networks incorporating CD20 as a regulatory component

When implementing these approaches, researchers should consider using both primary mouse B cells and cell lines, with appropriate controls including CD20-deficient cells or cells treated with anti-CD20 neutralizing antibodies .

How can researchers effectively validate the specificity of anti-CD20 antibodies in their experiments?

Validating the specificity of anti-CD20 antibodies is crucial for ensuring experimental rigor and reproducibility in CD20 research. Based on standard practices in antibody validation and the specific context of CD20, researchers should implement the following comprehensive validation strategy:

  • Positive and Negative Cell Controls:

    • Test antibodies on confirmed CD20-expressing cells (e.g., B lymphocytes) versus non-B cells known to lack CD20 expression

    • Include CD20 transfectants alongside irrelevant transfectants as described in the search results : "Stains human CD20 transfectants but not irrelevant transfectants"

    • Use multiple B cell lines representing different developmental stages to confirm consistent detection patterns

  • Isotype Controls:

    • Always include appropriate isotype controls (e.g., Mouse IgG1 for a mouse monoclonal anti-CD20) to distinguish specific from non-specific binding

    • Match the isotype control concentration exactly to the primary antibody concentration

  • Blocking/Competition Assays:

    • Pre-incubate antibodies with recombinant CD20 protein to demonstrate signal reduction through specific competition

    • Compare staining patterns before and after blocking to identify non-specific binding

  • Multi-technique Confirmation:

    • Validate antibody specificity across multiple techniques (flow cytometry, western blot, immunohistochemistry) using consistent positive and negative controls

    • For example, if using the antibody described in search result , confirm that it works in flow cytometry of PBMCs and in immunohistochemistry of paraffin-embedded tissue sections

  • Genetic Validation:

    • Test antibodies on samples from CD20 knockout models or CD20-silenced cells (siRNA/shRNA) to confirm absence of signal

    • Use CRISPR-Cas9 edited cells with partial CD20 deletions to map epitope recognition

  • Cross-reactivity Testing:

    • For antibodies claimed to be reactive across species (e.g., "Reactive Species: Human, Mouse, Rat" ), validate on samples from each species

    • Be particularly cautious with cross-reactive antibodies, as epitope conservation may vary

  • Epitope Mapping:

    • If possible, determine the specific epitope recognized by the antibody, especially relevant for the extracellular domain of 48 amino acids that shows 65% sequence identity between human and mouse CD20

    • This information helps predict potential cross-reactivity and functional effects

  • Functional Validation:

    • For antibodies intended to block CD20 function, confirm functional effects in appropriate assays measuring B cell activation or calcium flux

    • Neutralization assays can provide important information about antibody functionality beyond simple binding

When reporting results, researchers should document all validation steps performed and include detailed antibody information (vendor, catalog number, lot number, concentration used) to support experimental reproducibility.

How can CD20 expression analysis contribute to cancer immunotherapy research?

CD20 expression analysis provides valuable insights for cancer immunotherapy research, particularly in understanding the tumor immune microenvironment and developing targeted therapeutic strategies. Recent findings highlight several important methodological approaches and considerations:

  • Prognostic Value Assessment:

    • Higher expression of MS4A1 (CD20) correlates with favorable prognosis in Non-Small Cell Lung Cancer (NSCLC), suggesting tumor-suppressive functions of CD20+ B cells

    • Researchers should quantify CD20+ cell infiltration levels in tumor tissues and correlate with clinical outcomes to identify potential prognostic biomarkers

  • Tumor Microenvironment Characterization:

    • Single-cell transcriptome analysis reveals distinct B cell populations with different functional properties:

      • Naive-like B cells (CD20+/MS4A1+) expressing CD19, CD22, TCL1A, and CD83

      • Plasma-like B cells expressing CD38, TNFRSF17 (BCMA), and IGHG1/IGHG4

    • CD20+ cells show distinct localization patterns, primarily in tertiary lymphoid structures (TLS)

    • Methodologically, researchers should employ multi-parameter immunofluorescence or single-cell sequencing to characterize these populations

  • Correlation with Immunotherapy Response Markers:

    • B cell infiltration positively correlates with PD-1/PD-L1 expression and tumor mutation burden (TMB)

    • This suggests that patients with high B cell infiltration might benefit from anti-PD-1/PD-L1 immunotherapy

    • Researchers should integrate CD20 expression analysis with assessment of established immunotherapy response biomarkers

  • Functional Studies of CD20+ B Cells in Anti-tumor Immunity:

    • Culture supernatants from CD20+ B cells have demonstrated suppressive effects on lung cancer cell lines (A549 and H1299)

    • This indicates that CD20+ B cells may exert anti-tumor effects through secreted factors

    • Experimental approaches should include:

      • Isolation of CD20+ B cells from tumor tissues

      • Collection of conditioned media from these cells

      • Treatment of cancer cell lines with conditioned media

      • Assessment of cancer cell proliferation, apoptosis, and other functional readouts

  • Monitoring B Cell Dynamics During Cancer Progression:

    • CD20+CD79+ B cell infiltration decreases in advanced cancer stages (Stage III vs. Stage I NSCLC)

    • Flow cytometry and immunohistochemistry protocols should be standardized to accurately quantify these changes

    • Longitudinal samples should be collected when possible to track changes during disease progression

By integrating these methodological approaches, researchers can better understand how CD20-expressing B cells contribute to anti-tumor immunity and potentially identify new strategies for enhancing immunotherapy efficacy.

What are the differences between mouse and human CD20 that researchers should consider in translational studies?

Understanding the differences between mouse and human CD20 is crucial for researchers conducting translational studies. These differences impact experimental design, data interpretation, and the translational relevance of findings. Key considerations include:

By accounting for these species differences, researchers can design more translationally relevant studies and better predict how findings in mouse models might apply to human biology and therapeutics.

What experimental approaches can elucidate the role of CD20+ B cells in tertiary lymphoid structures?

The presence and significance of CD20+ B cells in tertiary lymphoid structures (TLS) represent an important area of investigation, particularly in cancer immunology. Based on the search results and methodological considerations, the following experimental approaches are recommended to elucidate their role:

These methodological approaches, applied in combination, can provide comprehensive insights into the role of CD20+ B cells within tertiary lymphoid structures in various disease contexts.

How can recombinant CD20 be utilized in developing novel B cell-targeted therapeutics?

Recombinant CD20 provides a valuable tool for developing and validating novel B cell-targeted therapeutics. Based on the search results and current research methodologies, the following approaches can be employed:

  • Antibody Development and Screening:

    • Epitope Mapping: Recombinant CD20 with partial protein length (e.g., 111-291aa) can be used to map specific epitopes for antibody targeting . This is particularly valuable given that the extracellular domain of CD20 is relatively small (48 amino acids) .

    • Phage Display Selection: Immobilized recombinant CD20 serves as a target for screening phage display libraries to identify novel binding molecules with diverse properties.

    • Affinity Maturation: Sequential binding studies against recombinant CD20 can guide affinity maturation of candidate therapeutic antibodies.

    • Cross-reactivity Assessment: Comparative binding assays using recombinant human and mouse CD20 can identify antibodies with cross-species reactivity, valuable for translational studies .

  • Bi-specific and Multi-specific Therapeutic Design:

    • Modular Construct Development: Recombinant CD20 can be used to validate binding modules for incorporation into bi-specific therapeutics that simultaneously target CD20 and other relevant targets.

    • Functional Screening: Cell-based assays incorporating recombinant CD20 can assess the functional activity of bi-specific constructs, including their ability to recruit effector cells or modulate signaling.

  • Mechanistic Studies to Inform Therapeutic Design:

    • Structure-Function Analysis: Recombinant CD20 variants with specific mutations can elucidate the relationship between structure and function, guiding rational therapeutic design.

    • Interaction Partner Identification: Pull-down assays using tagged recombinant CD20 (e.g., with the N-terminal 6xHis-tag) can identify novel interaction partners as potential co-targets .

    • Ion Channel Regulation Studies: Since CD20 plays a role in regulation of ion influx , recombinant protein can be used in reconstituted systems to study this function and identify potential modulators.

  • Therapeutic Validation and Optimization:

    • Competition Assays: Recombinant CD20 can be used in competition assays to assess binding specificity and potential off-target interactions of therapeutic candidates.

    • Stability and Formulation Studies: Different formulations of recombinant CD20 (liquid versus lyophilized) can inform optimal storage and delivery conditions for therapeutics .

    • Quality Control Benchmarking: Highly purified recombinant CD20 (>90% purity by SDS-PAGE) provides a reference standard for therapeutic development and quality control .

  • Immunization Strategies for Active Vaccination:

    • Vaccine Development: Recombinant CD20 fragments can be incorporated into vaccination strategies aimed at generating endogenous anti-CD20 responses.

    • Adjuvant Optimization: Various formulations of recombinant CD20 with different adjuvants can be tested to optimize immune responses for therapeutic purposes.

These methodological approaches leverage the availability of well-characterized recombinant CD20 to accelerate and enhance the development of novel B cell-targeted therapeutics with potential applications in autoimmune diseases, B cell malignancies, and other conditions where modulation of B cell function is therapeutically beneficial.

What are common challenges in working with recombinant CD20 and how can they be addressed?

Working with recombinant CD20 presents several technical challenges due to its nature as a membrane protein. Researchers should be aware of these issues and implement appropriate strategies to overcome them:

  • Protein Solubility and Aggregation Issues:

    • Challenge: As a membrane protein, CD20 contains hydrophobic domains that can lead to aggregation and poor solubility in aqueous solutions.

    • Solutions:

      • Use appropriate detergents or lipid environments to maintain native conformation

      • Consider working with partial protein constructs (111-291aa as in the search results) that exclude the most hydrophobic regions

      • Optimize buffer conditions (pH, ionic strength, stabilizing additives) to prevent aggregation

      • Employ fusion tags like the N-terminal 6xHis-tag that can improve solubility while facilitating purification

  • Maintaining Proper Protein Folding:

    • Challenge: Ensuring recombinant CD20 maintains its native conformation, especially for conformational epitopes relevant to antibody recognition.

    • Solutions:

      • Express in eukaryotic systems like yeast rather than prokaryotic systems

      • Include appropriate oxidizing environments to form disulfide bonds if present

      • Validate proper folding through circular dichroism (CD) spectroscopy or binding to conformation-sensitive antibodies

      • Consider co-expression with chaperone proteins to aid folding

  • Optimizing Expression Yields:

    • Challenge: Achieving sufficient quantities of properly folded protein for experimental use.

    • Solutions:

      • Systematic optimization of expression conditions (temperature, induction timing, media composition)

      • Consider codon optimization for the expression host

      • Test different fusion tags and their positions (N- or C-terminal)

      • Evaluate different host strains or expression systems

  • Storage Stability Considerations:

    • Challenge: Maintaining protein stability during storage and experimental use.

    • Solutions:

      • Compare stability in liquid form versus lyophilized powder preparations

      • For long-term storage, lyophilized preparations offer better stability

      • Include appropriate cryoprotectants for frozen storage

      • Aliquot stocks to avoid repeated freeze-thaw cycles

      • Monitor protein quality after storage through SDS-PAGE and functional binding assays

  • Functional Validation Approaches:

    • Challenge: Confirming that recombinant CD20 retains native functional properties.

    • Solutions:

      • Validate binding to well-characterized anti-CD20 antibodies

      • Assess association with lipid rafts in reconstituted membrane systems

      • Test ion channel regulatory functions in appropriate assay systems

      • Compare binding properties to those of native CD20 from B cell membranes

  • Tag Interference with Function:

    • Challenge: Purification tags may interfere with protein function or interactions.

    • Solutions:

      • Include cleavable tags with specific protease sites

      • Test protein function before and after tag removal

      • Position tags away from known functional domains

      • Validate that antibody binding is not affected by the presence of tags

By implementing these technical strategies, researchers can overcome common challenges associated with recombinant CD20 production and utilization, ensuring high-quality experimental outcomes.

How should researchers design optimal flow cytometry panels for comprehensive B cell phenotyping using CD20?

Designing optimal flow cytometry panels for comprehensive B cell phenotyping with CD20 requires careful consideration of marker selection, fluorochrome combinations, and sample preparation techniques. Based on the search results and best practices in flow cytometry, the following methodological approach is recommended:

  • Core B Cell Markers to Include with CD20:

    • CD19: Pan-B cell marker expressed from early development through differentiation (excluding plasma cells)

    • CD79A: B cell receptor-associated protein, co-expression with CD20 defines naive-like B cells

    • CD22: Expressed on mature B cells and some subpopulations

    • CD38: Differentially expressed during B cell development, high expression on plasma cells

    • IgD and IgM: Surface immunoglobulins for naive B cell identification

    • CD27: Memory B cell marker

  • Extended Panel for Detailed Subpopulation Analysis:

    • TCL1A: Naïve B cell marker

    • CD83: Activated B cell marker

    • TNFRSF17 (BCMA): Plasma cell marker

    • CD138 (Syndecan-1): Plasma cell marker

    • IGHG1/IGHG4: Class-switched B cells

    • Activation markers: CD69, CD80, CD86

    • Homing/trafficking markers: CXCR4, CXCR5, CCR7

  • Panel Design Considerations:

    • Fluorochrome Selection:

      • Assign brightest fluorochromes (PE, APC) to markers with lowest expression

      • Place markers never expressed on the same cell on the same channel (e.g., naive vs. plasma cell markers)

      • Account for spectral overlap and compensation requirements

      • When using CD20 and CD19 together, place them on well-separated channels to clearly distinguish populations

    • Control Samples:

      • Include appropriate isotype controls (e.g., Mouse IgG1 for mouse monoclonal antibodies)

      • Use FMO (Fluorescence Minus One) controls for accurate gating

      • Include single-stained controls for compensation

    • Antibody Validation:

      • Confirm antibody specificity using positive controls (CD20 transfectants) and negative controls (irrelevant transfectants)

      • Titrate antibodies to determine optimal concentration

  • Sample Preparation Protocol:

    • Staining Procedure:

      • Follow established staining protocols such as the "Staining Membrane-associated Proteins protocol" mentioned in the search results

      • For intracellular markers, use appropriate fixation and permeabilization reagents

      • Include viability dye to exclude dead cells

    • Sample Processing Considerations:

      • For tissue samples, optimize dissociation protocols to preserve CD20 expression

      • For blood samples, use red blood cell lysis that preserves lymphocyte markers

      • Process samples consistently to ensure comparable results

  • Data Acquisition and Analysis Strategy:

    • Gating Strategy:

      • Begin with FSC/SSC to identify lymphocytes

      • Gate on single cells and viable cells

      • Identify CD19+ B cells

      • Further characterize using CD20 and additional markers

      • Specifically analyze CD20+CD79A+ (naive-like) versus other B cell populations

    • Quantification Approaches:

      • Report both percentage and absolute numbers of B cell subsets

      • Consider measuring marker density (MFI) as well as positive/negative categorization

      • For clinical samples, track changes in CD20+ subpopulations across disease stages

  • Special Considerations for Tissue Samples:

    • When analyzing B cells from tumor tissues or other tissue samples, be aware that naive-like B cells (CD20+CD79A+) can show tissue-specific gene expression differences

    • For tumor tissue analysis, correlate flow cytometry findings with spatial location information from immunohistochemistry

This comprehensive approach to flow cytometry panel design enables detailed characterization of CD20-expressing B cell populations and their functional states across different biological contexts.

How does CD20 expression on B cells influence outcomes in autoimmune disease models?

CD20 expression on B cells plays a crucial role in autoimmune disease pathogenesis and treatment response. While the search results focus primarily on cancer models, the methodological approaches can be adapted to study CD20's role in autoimmune contexts. Based on the available information and established research approaches, the following framework is recommended:

  • Quantitative Assessment of CD20+ B Cell Subsets in Autoimmune Models:

    • Flow cytometry panels should include CD20 alongside other markers like CD19, CD27, CD38, and CD138 to identify specific B cell subpopulations relevant to autoimmunity

    • Distinguish between naive-like B cells (CD20+CD79A+) and other populations, similar to the approach used in cancer research

    • Track changes in these populations across disease progression and in response to therapeutic interventions

  • Spatial Distribution Analysis in Target Tissues:

    • Employ immunohistochemistry and immunofluorescence co-staining of CD20 with CD79A to characterize B cell distributions in affected tissues

    • Pay particular attention to tertiary lymphoid structures (TLS), which are common features in many autoimmune diseases and where CD20+ cells tend to localize

    • Quantify CD20+ cell density in relation to tissue damage and inflammatory markers

  • Functional Characterization of CD20+ B Cells in Autoimmunity:

    • Isolate CD20+ B cells from autoimmune disease models and analyze:

      • Cytokine production profiles (IL-6, IL-10, TNF-α)

      • Antigen presentation capacity to T cells

      • Autoantibody production

    • Assess cell-cell interaction networks using approaches like CellPhoneDB analysis to understand how CD20+ B cells communicate with other immune cells in the autoimmune microenvironment

  • CD20-Targeting Intervention Studies:

    • Design experiments using anti-CD20 antibodies in autoimmune models to assess:

      • Degree and duration of B cell depletion

      • Effects on autoantibody levels

      • Impact on tissue inflammation and damage

      • Influence on other immune cell populations (T cells, dendritic cells)

    • Compare outcomes between different anti-CD20 antibody clones to understand epitope-specific effects

  • Correlation with Clinical Parameters:

    • Develop scoring systems that correlate CD20+ B cell infiltration patterns with:

      • Disease severity measures

      • Response to B cell-targeted therapies

      • Long-term outcomes and relapse patterns

    • Similar to cancer research findings, establish whether specific CD20+ B cell populations correlate with better or worse prognosis

  • Mechanistic Studies of CD20 Function:

    • Investigate CD20's role in B cell receptor signaling and calcium flux in the context of autoimmunity

    • Examine how CD20 expression levels influence B cell activation thresholds and autoreactivity

    • Study the relationship between CD20 expression and B cell survival in inflammatory environments

  • Translational Relevance Assessment:

    • Compare findings between mouse models and human autoimmune disease samples

    • Consider the 65% sequence identity between mouse and human CD20 when interpreting results of targeting studies

    • Evaluate how findings in mouse models might predict clinical responses to CD20-targeted therapies

By implementing these methodological approaches, researchers can comprehensively assess how CD20 expression on B cells influences autoimmune disease initiation, progression, and treatment response, potentially identifying new therapeutic strategies or predictive biomarkers.

What role does CD20 play in B cell lymphoma models and how can recombinant CD20 aid in developing targeted therapies?

CD20 plays a central role in B cell lymphoma biology and represents a primary target for therapeutic intervention. Research using recombinant CD20 can significantly advance our understanding of lymphoma biology and facilitate the development of improved targeted therapies. The following methodological approaches are recommended:

  • Expression Pattern Analysis in Lymphoma Models:

    • Technique: Comprehensive immunophenotyping using flow cytometry and immunohistochemistry to characterize CD20 expression patterns

    • Application: Compare CD20 expression levels across different lymphoma subtypes, correlate with disease aggressiveness and treatment response

    • Method Detail: Employ validated antibodies like those referenced in the search results to quantify CD20 density on lymphoma cells and identify heterogeneity within tumors

    • Validation Approach: As demonstrated in search result , use lymphoma tissue sections for immunohistochemical detection of CD20: "CD20 was detected in immersion fixed paraffin-embedded sections of human leukemia using Mouse Anti-Human CD20 Monoclonal Antibody"

  • Functional Role Assessment:

    • Technique: Gene silencing or knockout approaches (siRNA, CRISPR-Cas9) to modulate CD20 expression in lymphoma cells

    • Application: Determine how CD20 expression impacts:

      • Cell survival and proliferation

      • Response to conventional chemotherapeutics

      • Calcium signaling and B cell receptor pathway activation

    • Method Detail: Measure changes in cell viability, cell cycle distribution, and calcium flux following CD20 modulation

  • Recombinant CD20 Applications for Therapeutic Development:

    • Technique: Antibody screening and characterization using recombinant CD20

    • Application: Use purified recombinant CD20 (with >90% purity as determined by SDS-PAGE ) to:

      • Screen candidate therapeutic antibodies

      • Map binding epitopes on CD20

      • Develop competition assays to characterize antibody binding affinity

    • Method Detail: Express recombinant CD20 with tags (e.g., N-terminal 6xHis-tag ) for immobilization in binding assays

    • Format Options: Utilize both liquid and lyophilized preparations depending on experimental needs

  • Structural Studies to Guide Therapeutic Design:

    • Technique: Structural analysis of CD20 and its complexes with therapeutic antibodies

    • Application: Generate detailed molecular understanding of:

      • CD20 conformation in the membrane

      • Antibody binding interfaces

      • Conformational changes induced by antibody binding

    • Method Detail: Use recombinant CD20 fragments in X-ray crystallography or cryo-EM studies

  • Development of Next-Generation CD20-Targeted Therapies:

    • Technique: Bi-specific antibody and antibody-drug conjugate (ADC) development

    • Application: Use recombinant CD20:

      • As a target component in bi-specific constructs linking CD20 targeting with T-cell engagement

      • To validate binding of ADC constructs before and after drug conjugation

    • Method Detail: Conduct binding studies followed by functional assays in lymphoma cell lines

  • Resistance Mechanism Investigation:

    • Technique: Analysis of CD20 mutations and expression changes in therapy-resistant lymphomas

    • Application: Create recombinant CD20 variants harboring identified mutations to:

      • Test impact on antibody binding

      • Evaluate effects on CD20 function

      • Develop strategies to overcome resistance

    • Method Detail: Site-directed mutagenesis of recombinant CD20 constructs followed by binding and functional studies

  • In Vivo Models for Therapeutic Validation:

    • Technique: Xenograft and syngeneic mouse models of B cell lymphoma

    • Application: Test CD20-targeted therapies developed using recombinant CD20 insights

    • Consideration: Account for the 65% sequence identity between human and mouse CD20 extracellular domains when designing cross-species studies

    • Method Detail: Monitor tumor growth, B cell depletion, and survival outcomes following therapy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.