Recombinant Mouse B1 bradykinin receptor (Bdkrb1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The mouse B1 bradykinin receptor (Bdkrb1) is a G protein-coupled receptor (GPCR) with seven transmembrane domains . It binds kinins such as desArg⁹-bradykinin and Lys-desArg⁹-bradykinin, which are generated during tissue injury or inflammation . Key features include:

PropertyDetails
Gene LocationChromosome 14 (mouse)
Protein Length353 amino acids (predicted)
UniProt IDQ61125 (mouse)
Signaling PathwayGq/11-coupled → Activates phospholipase Cβ → ↑ cytosolic Ca²⁺
InducibilityExpressed at low levels in healthy tissues; upregulated by LPS, cytokines, or tissue injury

Biological Role

  • Inflammation & Pain: Mediates chronic inflammatory responses, hyperalgesia, and neutrophil apoptosis .

  • Renal Protection: Reduces oxidative DNA damage and apoptosis during ischemia/reperfusion (I/R) injury. Studies in Bdkrb1⁻/⁻ mice show exacerbated renal dysfunction post-I/R .

  • CNS Effects: Low constitutive expression in rodent and primate brains influences blood-brain barrier integrity and neuroinflammation .

Renal Ischemia/Reperfusion Injury

  • Mortality & Pathology:

    • Bdkrb1⁻/⁻ mice exhibited higher mortality (40%) vs. wild-type (0%) after renal I/R .

    • Histological damage (tubular necrosis) and plasma creatinine levels were significantly elevated in Bdkrb1⁻/⁻ mice .

ParameterWild-TypeB2R⁻/⁻B1RB2R⁻/⁻
Mortality Rate0%28%40%
Plasma Creatinine (mg/dL)1.2 ± 0.32.1 ± 0.43.5 ± 0.6
TUNEL-positive Cells12 ± 325 ± 538 ± 7
  • Oxidative Stress: Bdkrb1⁻/⁻ kidneys showed elevated 8-OHdG (DNA oxidation marker) and mitochondrial DNA deletions .

Inflammatory Pathways

  • LPS and SAA1 upregulate Bdkrb1 mRNA and protein in amnion fibroblasts via TLR4 .

  • Blocking TLR4 with CLI-095 suppresses Bdkrb1 induction by 60–80% .

Therapeutic Implications

  • Knockout Phenotypes:

    • Bdkrb1⁻/⁻ mice develop normally but display hypoalgesia and reduced neutrophil infiltration during inflammation .

    • Exacerbated diabetic complications (hyperglycemia, vascular leakage) in streptozotocin-induced models .

  • Drug Targeting: B1 receptor antagonists (e.g., LF22-0542) are under investigation for chronic pain and inflammatory diseases .

Experimental Tools

  • Antibodies & Peptides:

    • Anti-Bdkrb1 antibodies (e.g., #ABR-013) validated in Western blot and flow cytometry .

    • Blocking peptide (BLP-BR013) used to confirm receptor specificity .

  • Cell Lines: Mouse BV-2 microglia and J774 macrophage lines show robust Bdkrb1 expression .

Comparative Analysis with B2 Receptor

FeatureB1 Receptor (Bdkrb1)B2 Receptor (Bdkrb2)
ExpressionInducible under stressConstitutive
LigandsdesArg⁹-BK, Lys-desArg⁹-BKBradykinin, Lys-BK
Role in I/R InjurySynergistic protection with Bdkrb2Primary protective receptor
Knockout PhenotypeEnhanced renal injuryModerate renal dysfunction

Future Directions

  • Elucidate Bdkrb1’s role in neuroinflammatory diseases.

  • Develop tissue-specific knockout models to dissect organ-level functions.

  • Explore dual B1/B2 receptor antagonists for combinatorial therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bdkrb1; Bdkrb; B1 bradykinin receptor; B1R; BK-1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSF FLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVV SGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTF LLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQK EASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLG LQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
Uniprot No.

Target Background

Function

This recombinant Mouse B1 bradykinin receptor (Bdkrb1) is a receptor for bradykinin, potentially playing a role in chronic pain and inflammation.

Gene References Into Functions

Research Highlights on the Role of the B1 Bradykinin Receptor:

  1. TRPA1 positively modulates B1 receptor-induced mechanical hyperalgesia in the spinal cord, involving classical GPCR downstream molecules. PMID: 27823962
  2. The host kinin B1 receptor exhibits a protective effect against melanoma progression. PMID: 26898917
  3. Studies have examined nitric oxide (NO) release, L-arginine (L-Arg) uptake, and cationic amino acid transporter (CAT)-1 expression in endothelial cells from B1 receptor knockout (B1-/-) and wild-type (WT) mice. PMID: 26446563
  4. The kinin B1R contributes to acute gouty attacks, including those facilitated by ACE inhibitors. PMID: 25344431
  5. Kinin B1 receptor deletion influences bone healing in type 1 diabetic mice with femoral defects. PMID: 25969420
  6. Kinin B1 receptor deficiency or antagonism reduces cisplatin-induced apoptosis. PMID: 24357263
  7. IL-4 and IL-13 decrease kinin receptor expression via a STAT6-dependent mechanism. PMID: 23351078
  8. Bradykinin plays a significant role in anti-collagen antibody-induced arthritis (CAIA), with bradykinin receptor beta 1 playing a key role in CAIA development. PMID: 24599920
  9. B(1) receptor deficiency alters plasma oxidant/antioxidant balance and induces moderate left ventricular dysfunction. PMID: 24020815
  10. The kinin B1 receptor significantly regulates skeletal muscle proteolysis in a levator ani muscle atrophy model. PMID: 24498923
  11. Genetic deletion of kinin B1R attenuates cognitive deficits and blocks IL-17 and IFN-gamma mRNA expression in autoimmune encephalitis mouse models. PMID: 23777652
  12. B1R activation limits amyloid-beta peptide accumulation in Alzheimer's disease-like brains. PMID: 23470163
  13. Bdkrb1 participates in the pathogenesis of ligature-induced experimental periodontitis bone loss, potentially through modulation of the TH17 response. PMID: 23534940
  14. Activation of the kinin B1 receptor attenuates melanoma tumor growth and metastasis. PMID: 23691222
  15. B1R and B2R receptors are crucial in persistent hypersensitivity in an experimental autoimmune encephalomyelitis model. PMID: 23454198
  16. Lack of kinin B1 receptor potentiates leptin action in the liver. PMID: 23385644
  17. B1 receptor deficiency exacerbates dextran sulfate sodium-induced colitis, potentially due to compensatory B2 receptor overexpression. PMID: 22889120
  18. Kinin B(1) receptor modulates insulin action in adipocytes, impacting systemic insulin sensitivity and obesity predisposition. PMID: 23024762
  19. Under normal sodium intake, epithelial Na(+) channel (ENaC) open probability is modestly elevated in bradykinin receptors B1R, B2R(-/-) mice. PMID: 23033373
  20. Kinin B1 receptors are important for modulating insulin secretion and maintaining normal glucose levels and hepatic function in obese mice. PMID: 22829877
  21. In the absence of B2R, both B1R and AT2R play compensatory roles in preventing cardiac dysfunction and remodeling post-myocardial infarction. PMID: 22849668
  22. Inflammatory muscle pain involves PKC, p38, and JNK activation, IL-1beta, TNF-alpha, and IL-6 synthesis, and upregulation of B(1) and B(2) kinin receptors. PMID: 22220695
  23. B(1) and B(2) receptors play distinct roles in modulating bradykinin-induced itch in complete Freund's adjuvant-inflamed mice. PMID: 22378823
  24. The B(1)R subtype plays a dual role in experimental autoimmune encephalomyelitis progression. PMID: 22132157
  25. Kinin receptor-deficient mice (B1 or B2 receptor knockout and B1B2 receptor double knockout) show significantly reduced paclitaxel-induced hypernociceptive responses. PMID: 21470206
  26. In mice lacking both B1 and B2 kinin receptors, baseline nociceptive responses to heat are unaltered, nocifensive responses to bradykinin are abolished, and acute acetic acid-induced visceral nociception is reduced by approximately 70%. PMID: 22273860
  27. Role of vascular kinin B1 receptors in endothelial nitric oxide metabolism. PMID: 21704095
  28. Treatment with R-954 reduced ascitic volume in Ehrlich tumor-bearing mice, suggesting B1 receptor involvement in tumor growth. PMID: 21835216
  29. B1 and B2 kinin receptors participate in hyperproliferative and inflammatory skin processes in mice. PMID: 21840178
  30. Wild-type bone marrow cell transplantation restores arteriogenesis in irradiated bradykinin B1 receptor mutant mice, while bone marrow chimeric mice exhibit reduced arteriogenesis after femoral artery occlusion. PMID: 21719759
  31. Bradykinin plays a crucial role in focal and segmental glomerulosclerosis through B1 receptor signaling. PMID: 21412216
  32. Kinin B1 receptors are involved in depressive behaviors, possibly through microglial activation and TNFalpha production. PMID: 21194425
  33. Bradykinin, acting through the B1 receptor, is implicated in lipopolysaccharide inhalation-induced acute lung injury. PMID: 20153312
  34. Bradykinin released from melanoma cells may cause pain and allodynia, with B(1) and B(2) receptors on primary afferent and melanoma cells potentially playing different roles. PMID: 19932979
  35. B1R(-/-) mice exhibit significantly smaller cortical lesions and neuronal damage after controlled cortical impact. PMID: 20197781
  36. Loss of bradykinin signaling does not worsen cardiac function or increase myocardial fibrosis in diabetes. PMID: 20501666
  37. Kinin B1 receptor (B1R) expression correlates with inflammation in rapidly progressive glomerulonephritides. PMID: 20448019
  38. Kinins acting on B(1) and B(2) receptors control PAR-2 activation-triggered pruriceptive signaling in mice. PMID: 20067469
  39. Lack of both B1R and B2R exacerbates various detrimental phenotypes in Akita diabetes, including albuminuria, glomerulosclerosis, mitochondrial DNA deletions, reduced nerve conduction velocity and heat sensation, and bone mineral loss. PMID: 20479236
  40. The B1 receptor may be involved in neurodegeneration and memory loss during aging. PMID: 20060587
  41. Laminar shear stress is a key determinant of functional B1R expression in endothelium. PMID: 19661485
  42. Bradykinin b1 receptor mRNA is upregulated after controlled cortical impact. PMID: 19773800
  43. Analysis of bradykinin B1 receptors in the mouse kidney. PMID: 19581823
  44. Specific B1 receptor activation causes protein kinase C epsilon isoform translocation to the membrane of sensory neurons. PMID: 15319421
  45. BKB1-R involvement in diabetic hyperalgesia in streptozotocin-mice through nitric oxide, substance P, and calcitonin gene-related peptide pathways. PMID: 15654512
  46. The bradykinin B1 receptor, upregulated in inflammatory diabetes, is crucial in diabetes-induced hyperalgesia. PMID: 15680494
  47. Targeted deletion of B1 receptors did not worsen remodeling after myocardial infarction, while B2 receptor blockade in B1-/- mice exaggerated left ventricular dysfunction and remodeling. PMID: 15699461
  48. Characterization of the B1 receptor structure and its regulated expression mechanism. PMID: 16006238
  49. TNFalpha participates in the functional upregulation of B(1) receptors in the mouse paw. PMID: 16039549
  50. Cardiac kinin-B1 receptor (kinin-B1R) is upregulated in heat-stressed mice and downregulated in L-arg-administered mice. PMID: 16205319
Database Links
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, liver and lung.

Q&A

What is the biological function of B1 Bradykinin Receptor (Bdkrb1) in mice?

The B1 Bradykinin Receptor is a G-protein coupled receptor that mediates the action of kinins, which are small peptides rapidly produced following tissue injury. In mice, Bdkrb1 serves as an important modulator of inflammation and pain signaling pathways. In the periphery, activation of Bdkrb1 contributes to vasodilatation, increased vascular permeability, stimulation of immune cells, and induction of pain. In the central nervous system, Bdkrb1 activation can initiate cascades leading to neural tissue damage and cause long-lasting disturbances affecting blood-brain barrier function . Unlike the constitutively expressed B2 receptor, Bdkrb1 is generally induced during inflammatory conditions, making it a particularly interesting target for studies of pathological states.

How does Bdkrb1 differ from B2 Bradykinin Receptor (Bdkrb2)?

Bdkrb1 and Bdkrb2 are distinct receptors that mediate the actions of different kinin peptides. While both are G-protein coupled receptors, they differ in ligand specificity, expression patterns, and signaling characteristics. Bdkrb1 preferentially binds to des-Arg9-bradykinin and Lys-des-Arg9-BK, while Bdkrb2 has higher affinity for bradykinin and Lys-bradykinin . A critical functional difference is that Bdkrb1 is generally not constitutively expressed but is induced during inflammation or tissue injury, whereas Bdkrb2 is constitutively expressed in many tissues. This inducible nature makes Bdkrb1 particularly relevant for studying inflammatory conditions and potential therapeutic interventions.

In which mouse tissues and cell types is Bdkrb1 commonly expressed or induced?

Bdkrb1 expression has been detected in multiple mouse tissues and cell lines, particularly following inflammatory stimulation. Western blot analyses have confirmed Bdkrb1 presence in mouse brain tissue and several mouse cell lines including BV-2 microglia, J774 macrophages, M1 myeloid leukemia cells, and Neuro-2a neuroblastoma cells . The receptor's expression is particularly notable in immune and inflammatory cells, consistent with its role in inflammatory processes. Flow cytometry has specifically demonstrated cell surface expression of Bdkrb1 in live intact mouse BV-2 microglia cells , highlighting the importance of this receptor in neuroimmune interactions within the central nervous system.

What are the optimal techniques for detecting endogenous versus recombinant Bdkrb1 expression in mouse models?

For detecting endogenous Bdkrb1 expression in mouse models, Western blot analysis using specific antibodies targeting the extracellular domain of the receptor has proven effective. Current protocols utilize antibodies such as Anti-B1 Bradykinin Receptor (BDKRB1) (extracellular) Antibody at dilutions of 1:400-1:500 for detection in tissue lysates from brain and heart, as well as various immune cell lines . For verifying specificity, blocking peptide controls are essential, as demonstrated by parallel experiments with the B1 Bradykinin Receptor (BDKRB1) (extracellular) Blocking Peptide .

For recombinant Bdkrb1, detection techniques depend on the expression system and tags utilized. When working with tagged recombinant proteins, anti-tag antibodies may provide higher sensitivity than anti-Bdkrb1 antibodies. Flow cytometry represents another valuable approach for cell surface detection of both endogenous and recombinant Bdkrb1, with protocols typically using 5μg of primary antibody followed by fluorophore-conjugated secondary antibodies such as goat-anti-rabbit-FITC . For maximum sensitivity, quantitative PCR remains the gold standard for detecting low-level expression, particularly during the early stages of inflammation-induced upregulation.

How can researchers effectively design functional assays to evaluate Bdkrb1 signaling pathways?

Designing effective functional assays for Bdkrb1 signaling requires careful consideration of receptor pharmacology and downstream signaling events. Given that Bdkrb1 couples primarily to Gq/11 proteins, calcium mobilization assays represent a primary approach for evaluating receptor activation. Researchers should incorporate specific agonists like des-Arg9-bradykinin while using antagonists such as AcLys[d-βNal7,Ile8]des-Arg9-bradykinin (pA2 of 8.5) as controls . To distinguish Bdkrb1 from Bdkrb2 signaling, selective antagonists for each receptor should be employed in parallel experiments.

For more comprehensive pathway analysis, researchers should monitor multiple signaling outputs including ERK1/2 phosphorylation, NF-κB activation, and production of inflammatory mediators such as cytokines and prostaglandins. Cell-based assays using reporter constructs (e.g., luciferase driven by NF-κB response elements) can provide quantitative readouts of pathway activation. When designing these assays, it is critical to include appropriate positive and negative controls, including cells lacking Bdkrb1 expression and competitive antagonism studies to confirm receptor specificity.

What strategies can be employed to develop stable recombinant mouse Bdkrb1 expression systems?

Developing stable recombinant mouse Bdkrb1 expression systems presents several challenges due to the receptor's potentially toxic effects when overexpressed. For mammalian expression systems, inducible promoters such as tetracycline-responsive elements offer advantages by allowing controlled expression levels. Lentiviral transduction often provides more consistent expression across cell populations compared to transient transfection methods. When designing expression constructs, incorporating a cleavable signal peptide followed by affinity tags at the N-terminus can facilitate purification while preserving receptor function.

For optimal expression, codon optimization based on the host cell system is recommended, as is the inclusion of chaperone proteins that assist with proper folding and trafficking of the receptor. Selection of an appropriate host cell line is crucial—HEK293 cells are commonly used due to their high transfection efficiency and minimal endogenous receptor expression. For stable cell line generation, single-cell cloning and thorough validation of expression levels through Western blotting, flow cytometry, and functional assays are essential steps. Additionally, researchers should monitor potential changes in receptor expression levels over passage number, as GPCRs often show decreased expression in long-term culture.

How should researchers design knockout or knockdown experiments to study Bdkrb1 function in mouse models?

When designing knockout experiments for Bdkrb1, researchers must consider both constitutive and conditional approaches. Constitutive knockouts using CRISPR-Cas9 targeting of the Bdkrb1 gene can provide insights into developmental roles, but may lead to compensatory upregulation of related pathways, particularly the B2 receptor signaling system. Conditional knockouts using Cre-loxP systems offer greater temporal and spatial control, allowing for tissue-specific or inducible deletion of Bdkrb1, which is particularly valuable for studying acute inflammatory responses without developmental compensation.

For knockdown approaches, siRNA and shRNA strategies targeting mouse Bdkrb1 mRNA have proven effective in reducing receptor expression in cell culture models. When designing siRNAs, researchers should target regions unique to Bdkrb1 to avoid off-target effects on Bdkrb2 or other related GPCRs. Validation of knockout or knockdown efficiency is essential and should employ multiple techniques including qPCR, Western blotting with specific antibodies, and functional assays measuring receptor-mediated responses to des-Arg9-bradykinin. Importantly, researchers should include appropriate controls such as scrambled siRNAs and wildtype littermates to accurately interpret experimental outcomes.

What experimental controls are essential when working with recombinant Bdkrb1 in vitro?

Several experimental controls are essential when working with recombinant Bdkrb1 in vitro. First, specificity controls must include parallel experiments with selective Bdkrb1 antagonists like AcLys[d-βNal7,Ile8]des-Arg9-bradykinin to confirm that observed effects are receptor-mediated . Mock-transfected cells and cells expressing unrelated GPCRs serve as important negative controls for distinguishing specific from non-specific effects. To control for expression level variations, normalization to surface receptor density measured by flow cytometry or binding assays is recommended.

When conducting signaling studies, researchers should include positive controls for downstream pathway activation independent of receptor engagement. For example, direct activators of G proteins or calcium ionophores can verify that signaling machinery remains functional. To differentiate Bdkrb1 from Bdkrb2 signaling, selective agonists and antagonists for each receptor should be employed in parallel. Additionally, antibody specificity controls using blocking peptides are crucial when performing immunodetection methods, as demonstrated in Western blot analyses where pre-incubation with B1 Bradykinin Receptor Blocking Peptide effectively eliminates specific signals .

What are the most reliable methods for quantifying Bdkrb1 expression levels in transgenic mouse models?

Quantifying Bdkrb1 expression in transgenic mouse models requires a multi-faceted approach. At the mRNA level, quantitative RT-PCR using validated primer sets specific to mouse Bdkrb1 provides sensitive detection of transcriptional changes. Primers should be designed to span exon-exon junctions to avoid amplification of genomic DNA. Digital droplet PCR offers advantages for absolute quantification of low-abundance transcripts typical of Bdkrb1 in non-inflammatory states.

For protein-level quantification, Western blotting using validated antibodies against the extracellular domain of Bdkrb1 at dilutions of 1:400-1:500 has proven effective for detecting the receptor in mouse tissue lysates . Flow cytometry represents the gold standard for quantifying cell surface expression in isolated primary cells, typically using 5μg of anti-Bdkrb1 antibody . For tissue distribution studies, immunohistochemistry with appropriate blocking peptide controls helps visualize receptor localization. Receptor binding assays using radiolabeled or fluorescent ligands provide functional quantification of available binding sites, though these require careful optimization due to the relatively low affinity of some Bdkrb1 ligands compared to B2 receptor ligands.

How do researchers resolve contradictory findings regarding Bdkrb1 signaling in different experimental systems?

Resolving contradictory findings regarding Bdkrb1 signaling requires systematic investigation of methodological differences between studies. Differences in expression systems (transient vs. stable, cell type selection) can significantly impact receptor coupling to downstream effectors. Researchers should comprehensively document and compare experimental conditions including agonist concentrations, exposure times, and cell passage numbers, as these factors can influence signaling outcomes.

When conflicting results emerge between in vitro and in vivo models, researchers should consider the complexity of the in vivo environment, where factors like receptor desensitization, internalization kinetics, and cross-talk with other signaling pathways may differ substantially from simplified cell culture systems. Additionally, species differences between mouse and human Bdkrb1 should be examined, as variations in receptor structure can affect ligand binding and signaling properties. A particular consideration for Bdkrb1 research involves the inflammatory state of the experimental system, as receptor expression and function are highly context-dependent. Meta-analysis approaches and direct side-by-side comparison of methods are often necessary to identify the source of discrepancies and develop a unified model of Bdkrb1 signaling.

What statistical approaches are most appropriate for analyzing dose-response data for Bdkrb1 agonists and antagonists?

For analyzing dose-response data related to Bdkrb1 pharmacology, nonlinear regression models are most appropriate, particularly the four-parameter logistic model for full agonists and antagonists. This approach enables determination of key pharmacological parameters including EC50/IC50 values, maximum response (Emax), and Hill coefficients. For partial agonists, which are common in Bdkrb1 pharmacology, models incorporating both affinity and efficacy parameters should be employed.

When analyzing competitive antagonism, Schild regression analysis provides valuable information about antagonist mechanism and potency, yielding pA2 values as seen with B1 receptor antagonists like AcLys[d-βNal7,Ile8]des-Arg9-bradykinin (pA2 of 8.5) . For complex pharmacological scenarios involving allosteric modulation or biased signaling, operational models of agonism and bias factors should be calculated. Statistical comparison between treatment groups should employ ANOVA with appropriate post-hoc tests for multiple comparisons, while accounting for biological variability with sufficient technical and biological replicates (minimum n=3-4). Importantly, researchers should report both the statistical significance and the effect size to properly contextualize their findings.

How can researchers effectively distinguish between direct effects of Bdkrb1 activation and secondary effects due to inflammatory mediator production?

Distinguishing between direct Bdkrb1 activation effects and secondary inflammatory cascade effects requires careful experimental design. Time-course studies represent a primary approach, as direct receptor-mediated effects typically occur within minutes (calcium mobilization, ERK phosphorylation), while secondary effects mediated by induced gene expression take hours to develop. Selective Bdkrb1 antagonists such as AcLys[d-βNal7,Ile8]des-Arg9-bradykinin should be applied at different time points to determine when receptor blockade no longer prevents downstream effects .

Researchers should employ cyclooxygenase inhibitors, cytokine neutralizing antibodies, or specific pathway inhibitors to block potential secondary mediators while monitoring Bdkrb1-dependent responses. Cell-specific knockout models are particularly valuable, as they allow researchers to determine whether effects require Bdkrb1 expression in specific cell populations or can occur through paracrine signaling mechanisms. Additionally, transcriptomic and proteomic approaches comparing early and late response patterns after Bdkrb1 activation can help categorize primary versus secondary effects. For in vivo studies, microdialysis techniques combined with mass spectrometry can help monitor local changes in inflammatory mediators following receptor activation.

What are the current challenges in developing selective agonists and antagonists for mouse Bdkrb1?

Developing selective compounds for mouse Bdkrb1 faces several challenges, primarily related to receptor selectivity and pharmacokinetic properties. Structure-activity relationship studies have identified that modifications at positions 7 and 8 of des-Arg9-bradykinin significantly affect receptor selectivity and antagonist potency . For example, replacement of Pro7 with d-Tic combined with Leu, Ile, Ala, or d-Tic in position 8 produces weak B1 receptor antagonists, some with residual B2 receptor agonist activity . The most promising antagonist identified incorporates d-βNal in position 7 combined with Ile in position 8 and AcLys at the N-terminal (AcLys[d-βNal7,Ile8]des-Arg9-bradykinin), achieving a pA2 of 8.5 on rabbit aorta and human umbilical vein .

A significant challenge remains in developing compounds with suitable metabolic stability, as bradykinin-related peptides are rapidly degraded by peptidases including angiotensin-converting enzyme. Research has shown that incorporating d-amino acids at position 7 can enhance resistance to enzymatic degradation . Additionally, species differences between mouse and human Bdkrb1 create complications for translational research, as compounds optimized for mouse receptors may show different selectivity profiles in human tissues. Future development should focus on non-peptidic small molecules with improved bioavailability and blood-brain barrier penetration to facilitate in vivo studies of central Bdkrb1 functions.

How does post-translational modification affect Bdkrb1 function and signaling properties?

Post-translational modifications significantly impact Bdkrb1 function through effects on receptor trafficking, ligand binding, and signaling coupling. Phosphorylation of intracellular domains represents a primary regulatory mechanism, with several kinases including PKC, GRK, and MAPK capable of phosphorylating specific serine and threonine residues. These phosphorylation events typically lead to β-arrestin recruitment, receptor desensitization, and internalization, though the kinetics differ substantially from the rapidly desensitizing B2 receptor.

N-glycosylation of extracellular domains affects receptor maturation and membrane trafficking. Recombinant expression systems must therefore maintain appropriate glycosylation machinery to produce functionally relevant Bdkrb1 proteins. Palmitoylation of cysteine residues influences receptor localization to membrane microdomains, affecting coupling efficiency to various signaling pathways. Ubiquitination regulates receptor degradation pathways and recycling efficiency after internalization.

Importantly, different inflammatory conditions may induce distinct patterns of post-translational modifications, creating context-specific signaling profiles. Researchers investigating Bdkrb1 should therefore consider not only total receptor expression but also modification status when interpreting functional data. Techniques such as phospho-specific antibodies, glycosylation inhibitors, and site-directed mutagenesis of modification sites provide valuable tools for dissecting these regulatory mechanisms.

What insights have structural biology approaches provided regarding Bdkrb1 ligand binding and activation mechanisms?

Structural biology approaches, though challenging for GPCRs like Bdkrb1, have provided valuable insights into receptor function. While full crystal or cryo-EM structures of mouse Bdkrb1 remain elusive, homology modeling based on related GPCRs combined with site-directed mutagenesis has identified key residues involved in ligand binding. The extracellular loops, particularly the second extracellular loop containing residues 202-214 (HEAWHFVRMVELN), play crucial roles in ligand recognition .

Molecular dynamics simulations have suggested that des-Arg9-bradykinin interacts primarily with the extracellular portions of transmembrane helices and extracellular loops, with key ionic interactions between the C-terminal carboxylate group of the ligand and positively charged residues in the receptor. The conformational changes associated with receptor activation involve rearrangements of transmembrane helices, particularly helices 3, 6, and 7, exposing intracellular binding sites for G proteins.

Recent advances in computational approaches, including machine learning-assisted molecular modeling, continue to refine our understanding of the Bdkrb1 binding pocket and activation mechanisms. These insights guide rational design of novel ligands with improved selectivity profiles. Future structural biology efforts should focus on capturing the receptor in multiple conformational states, particularly in complex with various ligands and downstream effectors, to fully elucidate the structural basis of biased signaling through this receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.