Recombinant Mouse Bcl-2 homologous antagonist/killer (Bak1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bak1; Bak; Bcl-2 homologous antagonist/killer; Apoptosis regulator BAK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-209aa
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS
Uniprot No.

Target Background

Function
Upon appropriate stimulation, this protein accelerates programmed cell death by binding to and antagonizing the anti-apoptotic function of BCL2.
Gene References Into Functions

Relevant Literature Supporting the Function of BAK1:

  1. Bax and Bak double knockout in proximal tubules attenuated renal tubular cell apoptosis and suppressed renal interstitial fibrosis in unilateral ureteral obstruction (UUO). PMID: 28317867
  2. Identification of the proximal α1-α2 loop as a second activation site in Bak and mitochondrial Bax. PMID: 27217060
  3. Demonstration of Bax/Bak1 deficient mouse embryonic fibroblasts' resistance to autophagy-associated cell death through lysosome permeability modulation. PMID: 29148970
  4. BH3-only proteins bind inactive full-length BAK at mitochondria, dissociating after BH3 and BH4 domain exposure, preceding BAK homodimerization. PMID: 28673969
  5. Determination of the mouse Bak BH3-in-groove homodimers (BGH) structure, revealing oligomerization via the 'α3/α5 interface' in mitochondria, suggesting a role in the mitochondrial apoptotic pore assembly. PMID: 27488021
  6. Proposed role of glucocorticoid-induced mitochondrial Bax accumulation and the interaction between the glucocorticoid receptor (GR) and Bim, Bcl-xL, and Bak in thymocyte apoptosis regulation. PMID: 27888447
  7. Structure-based design converting Bim-BH3 from Bak activator to inhibitor. PMID: 29149594
  8. Activity-dependent, non-apoptotic Bax/Bak-caspase signaling cascade requirement for postnatal synaptic rearrangement crucial for skilled behavior acquisition. Adult Bax/Bak mutant mice exhibited aberrant co-activation of antagonistic muscle pairs and skilled grasping deficits. PMID: 28472660
  9. Observation of Bak activation and its binding to p53 during reovirus encephalitis. PMID: 27307572
  10. Pancreatic beta-cell death due to Pdx-1 deficiency requiring Bax but not Bak. PMID: 27137932
  11. Analysis of lipid profiles in Bax and Bak deficient mouse embryonic fibroblasts. PMID: 26059977
  12. α1 dissociation as a key step in Bak unfolding into three components (N-terminus, core, latch) necessary for apoptosis. PMID: 25880232
  13. Non-apoptotic role of BAX and BAK in eicosanoid metabolism during inflammation. PMID: 25815636
  14. Puma as the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization. PMID: 26030884
  15. VDAC2 motifs required for mitochondrial Bak import and tBid-induced apoptosis. PMID: 26417093
  16. Dual ablation of Bax and Bak suppressing ureteral obstruction-induced inflammation and kidney fibrosis with decreased tubular cell cycle arrest. PMID: 26180237
  17. Bak regulation of gastric epithelial cell apoptosis, proliferation, differentiation, mucosal thickness, and susceptibility to gastric atrophy and dysplasia following H. felis infection. PMID: 26159699
  18. Benzo(a)pyrene-7,8-diol-9,10-epoxide induced p53-independent necrosis via the mitochondria-associated pathway involving Bax and Bak activation. PMID: 24837741
  19. MCL1, but not BAK, forming stable heterodimeric complexes with cBID, adjustable by membrane cardiolipin content and curvature. PMID: 25987560
  20. Mitochondrial permeability transition pore (MPTP) as an inner membrane-regulated process, with outer membrane resistance to swelling and prevention of organelle rupture in the absence of Bax/Bak. PMID: 23991283
  21. Aβ oligomers binding to BAK on the membrane, inducing apoptotic BAK pores and cytochrome c release. PMID: 25296312
  22. Proapoptotic function of PDI and PDIA3 through Bak-dependent mitochondrial outer membrane permeabilization. PMID: 25697356
  23. Elevated platelet lifespan in vavP-BCL-2 mice, similar to Bak(-/-) mice. PMID: 24464220
  24. ATF3 downstream of JNK signaling repressing pro-apoptotic Bak and Bax transcription after TLR engagement. PMID: 23697557
  25. Indirect effect of anti-apoptotic Bcl-2 family members on autophagy through Bax and Bak inhibition. PMID: 24912196
  26. Critical role of Bax and Bak in tubular cell apoptosis during ischemic acute kidney injury. PMID: 23466994
  27. Insights into BAK oligomeric pore organization by BAK homodimers during mitochondrial apoptosis, proposing a BAK-induced lipidic pore with a 'wormhole' topography. PMID: 24337568
  28. Puma as a direct Bak activator, similar to Bim, Noxa, and tBid. PMID: 24265320
  29. Multiple mechanisms of N-Bak mRNA translational repression. PMID: 23969856
  30. Mechanism-based apoptosis induction in Mcl-1 deficient embryonic fibroblasts (MEFs) reliant on Bcl-XL, and in Bax/Bak deficient MEFs. PMID: 23767404
  31. Lack of noticeable defects from combined BOK and BAK loss, with potential critical roles in developmental cell death. PMID: 23744350
  32. Bak apoptotic pore formation through BH3:groove homodimer multimerization, with Bak α6 involvement in oligomerization, function, and BH3-only protein activation. PMID: 23893415
  33. Role of BAX/BAK in long-term regulation of Nestin-positive progenitor cell pools, with loss of function predisposing to adult-onset tumorigenesis. PMID: 22986529
  34. Novel roles for Bax and/or Bak in skeletal muscle, revealed by altered mitochondrial morphology and defective protein import in Bax/Bak-deficient mice. PMID: 23784543
  35. Requirement of murine cytomegalovirus-mediated Bak inhibition for optimal in vivo replication. PMID: 23468630
  36. P2Y(12) activation protecting platelets from apoptosis via PI3k-dependent Bak/Bax inactivation. PMID: 23140172
  37. Distinct trigger sites for BAK and BAX activation initiated by direct BH3-interaction. PMID: 23404709
  38. Critical role of Bak, and ancillary role of Bax, in maintaining immunological tolerance and preventing autoimmune disease. PMID: 23349374
  39. Essential role of the p53-Bak apoptotic signaling axis in lens differentiation regulation. PMID: 22671997
  40. BAX/BAK-independent cell death not requiring Cyclophilin D (CypD), a key mitochondrial permeability transition pore regulator. PMID: 22719850
  41. Significant Bak deletion inhibition of hepatocyte apoptosis in Mcl-1 KO mice and reduced liver cancer incidence. PMID: 22414765
  42. Activation of both apoptotic and autophagic signaling pathways in denervation-induced muscle disuse, without compensatory autophagic protein expression increase despite attenuated apoptosis. PMID: 22673615
  43. Withanolide D eliciting apoptosis in malignant cells through a Bax/Bak-dependent pathway in p53-wild type cells, with Bak compensating for Bax loss in p53-null cells. PMID: 22479585
  44. Protective role of Bak during ionophore-induced cell death associated with its regulation of autophagic flux and vacuole homeostasis. PMID: 22493436
  45. Functional redundancy of Bax and Bak, counteracted by distinct anti-apoptotic Bcl-2 family proteins in different species. PMID: 22056880
  46. Predominantly independent regulation of Bak and Bax by Mcl-1 from their initial subcellular localizations. PMID: 22442658
  47. Strong translational arrest of N-Bak mRNA in neurons, partially mediated by the 5' untranslated region, not released during mitochondrial apoptosis. PMID: 22297299
  48. Protection against a Bax/Bak-independent cell death pathway initiated by the p20 fragment of Bap31 by endoplasmic reticulum-localized Bcl2. PMID: 22197342
  49. Coordination of BAK/BAX activation and apoptosis through BH3-only proteins and a specific lipid environment maintained by heterotypic membrane-mitochondrial interactions. PMID: 22385963
  50. Critical role of either Bak or Bax for rapid Fas-mediated massive liver apoptosis; delayed mitochondria-independent, caspase-dependent apoptosis develops without both. PMID: 21425311
Database Links

KEGG: mmu:12018

STRING: 10090.ENSMUSP00000077757

UniGene: Mm.2443

Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is Bak1 and what is its primary function in cellular processes?

Bak1 (Bcl-2 homologous antagonist/killer) is a pro-apoptotic member of the Bcl-2 protein family that plays a critical role in the intrinsic (mitochondrial) apoptosis pathway. It functions as a key regulator of outer mitochondrial membrane permeability, which when activated leads to the release of cytochrome c from the mitochondria into the cytosol. This release activates the apoptosome and downstream caspases, ultimately resulting in programmed cell death. Bak1, together with Bax, forms what is considered an essential gateway for cells to undergo intrinsic apoptosis .

How does Bak1 relate to other Bcl-2 family proteins in apoptotic regulation?

Bak1 functions within a complex network of Bcl-2 family proteins that includes both pro-apoptotic and anti-apoptotic members. Anti-apoptotic proteins (such as Bcl-2, Bcl-XL, and MCL1) can bind to and inhibit Bak1, preventing mitochondrial outer membrane permeabilization. BH3-only proteins like BIM, PUMA, and BMF act as upstream regulators that can counter the anti-apoptotic activity of Bcl-2, Bcl-XL, and MCL1, thereby indirectly activating Bak1 . Upon activation, Bak1 undergoes conformational changes and oligomerizes to form pores in the mitochondrial membrane, allowing cytochrome c release and initiating the caspase cascade leading to apoptosis .

What experimental evidence supports the role of Bak1 in mitochondrial apoptosis?

Multiple experimental approaches have confirmed Bak1's critical role in apoptosis:

  • Genetic deletion studies: In murine lymphoid cells, deletion of both Bax and Bak1 prevents rapid apoptosis in response to apoptotic stimuli like dexamethasone .

  • Cytochrome c release assays: Bak1 activation correlates with cytochrome c release from mitochondria into the cytosol, a hallmark of intrinsic apoptosis .

  • Caspase activation studies: Bak1-mediated mitochondrial permeabilization leads to measurable downstream caspase activation .

  • Cell viability analyses: Cells with functional Bak1 show characteristic loss of plasma membrane integrity (as measured by propidium iodide uptake) following apoptotic stimuli .

What are the optimal storage and handling conditions for recombinant mouse Bak1 protein?

Recombinant mouse Bak1 protein requires careful handling to maintain its biological activity. Store the unopened product at -20 to -70°C in a manual defrost freezer. Avoid repeated freeze-thaw cycles that can compromise protein integrity. Unlike some recombinant proteins that benefit from carrier proteins like BSA, certain applications may require carrier-free preparations of Bak1 to prevent interference . For long-term storage, aliquoting the protein into single-use volumes before freezing is recommended to minimize freeze-thaw cycles. When reconstituting lyophilized protein, use only the recommended buffers to ensure proper folding and activity.

What methodology should be used to verify Bak1 activity in experimental systems?

To verify Bak1 activity, researchers should employ multiple complementary approaches:

  • Functional assays:

    • Cytochrome c release assays using isolated mitochondria

    • Caspase activation measurements using fluorogenic substrates

    • Cell viability assessments using PI uptake or other viability markers

  • Biochemical confirmation:

    • Western blot analysis to confirm expression levels and molecular weight

    • Conformational antibodies that recognize the active form of Bak1

    • Co-immunoprecipitation to assess interactions with other Bcl-2 family proteins

  • Cell-based validation:

    • Reintroduction of recombinant Bak1 into Bak1-deficient cells should restore apoptotic sensitivity

    • Concentration-dependent effects should be demonstrated

    • Appropriate controls including Bak1/Bax double knockout cells should be included

How can mouse Bak1 be detected and quantified in experimental samples?

Multiple detection methods are available for mouse Bak1:

  • ELISA: Commercially available ELISA kits (like the Mouse Bak1/Bcl-2 homologous antagonist/killer ELISA Kit) allow sensitive and specific quantification of Bak1 protein in biological samples .

  • Western blotting: Using appropriate antibodies with recombinant mouse Bak1 as a standard. Sensitivity can be enhanced using chemiluminescent detection methods.

  • Immunofluorescence: For visualizing subcellular localization of Bak1, particularly its association with mitochondria during apoptosis.

  • Flow cytometry: For analyzing Bak1 expression or activation at the single-cell level, using conformation-specific antibodies to distinguish between inactive and active forms.

When quantifying Bak1, researchers should establish standard curves using recombinant Bak1 protein of known concentration and ensure proper controls for specificity.

How can Bak1/Bax knockout systems be utilized to investigate alternative apoptotic pathways?

Bak1/Bax double knockout systems provide powerful tools for exploring alternative apoptotic mechanisms:

  • Creation of knockout models: Using CRISPR/Cas9 technology to generate Bak1/Bax double knockout cell lines, as demonstrated with WEHI7 thymoma cells .

  • Extended treatment protocols: While Bak1/Bax-deficient cells resist rapid apoptosis, extended exposure to apoptotic stimuli (e.g., dexamethasone for >6 days) can still induce cell death characterized by cytochrome c release and caspase activation .

  • Triple knockout analysis: Further deletion of additional apoptotic regulators (e.g., BIM) in Bak1/Bax-deficient backgrounds has revealed that BIM contributes to delayed apoptosis even in the absence of Bak1/Bax .

  • Recovery experiments: Following extended treatment with apoptotic stimuli, removal of the stimulus allows assessment of long-term survival and clone-forming efficiency. Triple knockout cells (Bak1/Bax/BIM) show 10-fold higher clone-forming efficiency than Bak1/Bax double knockout cells after dexamethasone treatment and removal .

  • Inducible expression systems: Controlled re-expression of individual proteins in knockout backgrounds allows precise determination of their contributions to apoptotic mechanisms .

Cell TypeTreatment3-day PI+ cells12-day PI+ cellsClone-forming efficiency after Dex removal
Wild-type1μM Dexamethasone>90%N/AN/A
Bak1-/-Bax-/-1μM Dexamethasone<10%~75%Baseline
Bak1-/-Bax-/-Bim-/-1μM Dexamethasone<10%<10%10-fold higher than Bak1-/-Bax-/-

What is the significance of BIM-dependent, BAX/BAK1-independent cell death pathways?

The discovery of BIM-dependent but BAX/BAK1-independent cell death has profound implications for apoptosis research:

  • Challenge to conventional models: This finding challenges the dogma that BAX and BAK1 are absolutely essential for intrinsic apoptosis pathway activation .

  • Novel mechanisms: While BH3-only proteins like BIM were thought to require BAX or BAK1 to kill cells, research in WEHI7 thymoma cells shows that deletion of BIM in addition to BAX and BAK1 prevented delayed dexamethasone-induced cell death. This suggests BIM can trigger alternative cytochrome c release mechanisms in the absence of BAX/BAK1 .

  • Temporal considerations: BAX/BAK1-independent mechanisms operate with delayed kinetics (days rather than hours), suggesting they may represent a backup system when conventional apoptosis fails .

  • Therapeutic implications: Understanding these alternative pathways could lead to new therapeutic strategies for treating cancers resistant to conventional apoptosis inducers due to BAX/BAK1 mutations.

  • Synergistic mechanisms: BIM alone is not sufficient to induce death of BAX/BAK1-deficient cells, but becomes effective when combined with dexamethasone, suggesting multiple factors contribute to this alternative pathway .

How do experimental parameters affect Bak1-mediated apoptotic responses?

Several experimental parameters critically influence Bak1-mediated apoptotic responses:

  • Stimulus type and duration: While short-term dexamethasone treatment (24-48h) requires BAX/BAK1 for apoptosis in lymphoid cells, extended treatment (>6 days) can activate BAX/BAK1-independent mechanisms .

  • Protein expression levels: The balance between pro-apoptotic (Bak1, Bax, BIM) and anti-apoptotic (Bcl-2, Bcl-XL, MCL1) proteins determines apoptotic sensitivity.

  • Cell type specificity: Different cell lineages show varying dependencies on Bak1. The studies with WEHI7 thymoma cells and another dexamethasone-sensitive lymphoid line derived from p53-/- mice demonstrated similar delayed death mechanisms, suggesting this phenomenon may be common in lymphoid cells .

  • Genetic background: The broader genetic context, including p53 status and expression of other apoptotic regulators, significantly impacts Bak1-dependent responses .

  • Experimental readouts: Choosing appropriate endpoints (e.g., PI uptake, cytochrome c release, caspase activation) and timepoints is crucial for accurately interpreting Bak1's role in apoptosis .

What are common pitfalls in Bak1 recombinant protein studies and how can they be avoided?

Several challenges commonly arise when working with recombinant Bak1:

  • Protein stability issues: Bak1 is prone to aggregation and misfolding. To minimize these problems:

    • Strictly adhere to recommended storage conditions (-20 to -70°C)

    • Avoid repeated freeze-thaw cycles

    • Use freshly prepared protein for critical experiments

    • Consider adding stabilizing agents when appropriate

  • Functional assessment challenges: Confirming activity requires multiple complementary approaches:

    • Include positive controls (e.g., known Bak1 activators)

    • Use parallel assays (cytochrome c release, caspase activation)

    • Include concentration-response analyses

  • Interference from carrier proteins: For applications sensitive to carrier proteins:

    • Use carrier-free preparations when available

    • Include appropriate buffer-only controls

    • Consider the impact of carrier proteins on experimental readouts

  • Reproducibility concerns: To enhance reproducibility:

    • Document lot-to-lot variation

    • Standardize protocols across experiments

    • Validate key findings with independent protein preparations

How can researchers distinguish between Bak1-dependent and Bak1-independent cell death mechanisms?

Distinguishing between these mechanisms requires systematic experimental approaches:

  • Genetic manipulation: Generate and validate:

    • Bak1 single knockout cells

    • Bax single knockout cells

    • Bak1/Bax double knockout cells

    • Triple knockout cells (adding BIM or other candidates)

  • Time course analysis: Monitor cell death over extended periods (days to weeks) as Bak1-independent mechanisms may operate with delayed kinetics .

  • Molecular markers: Assess:

    • Cytochrome c release patterns

    • Caspase activation profiles

    • Mitochondrial membrane potential changes

    • Plasma membrane integrity (PI uptake)

  • Pharmacological inhibitors: Use:

    • Pan-caspase inhibitors to determine if cell death is caspase-dependent

    • Inhibitors of other death pathways (necroptosis, ferroptosis)

    • BH3-mimetics to probe Bcl-2 family involvement

  • Rescue experiments: Attempt to rescue viability through:

    • Overexpression of anti-apoptotic proteins

    • Genetic deletion of additional pro-death factors

    • Inducible re-expression systems

What controls are essential when studying Bak1's role in apoptotic pathways?

Rigorous experimental design requires these essential controls:

  • Genetic controls:

    • Wild-type cells (positive control for normal apoptotic responses)

    • Bak1 single knockout (to assess Bax compensation)

    • Bax single knockout (to assess Bak1 compensation)

    • Bak1/Bax double knockout (to reveal alternative pathways)

  • Treatment controls:

    • Vehicle control (to establish baseline viability)

    • Time-matched untreated controls

    • Positive control apoptosis inducers (e.g., dexamethasone for lymphoid cells)

  • Methodological controls:

    • Technical replicates to assess experimental variation

    • Biological replicates using independent clones

    • Multiple cell death assays to confirm findings (PI uptake, caspase activation, cytochrome c release)

  • Rescue controls:

    • Re-expression of Bak1 in knockout cells should restore apoptotic sensitivity

    • Overexpression of anti-apoptotic proteins should inhibit Bak1-dependent (but potentially not all Bak1-independent) death

What are emerging areas of investigation regarding Bak1's role beyond canonical apoptosis?

Several exciting research frontiers are expanding our understanding of Bak1:

  • Non-apoptotic functions: Increasing evidence suggests Bak1 may participate in cellular processes beyond apoptosis, including mitochondrial dynamics, calcium homeostasis, and cellular stress responses.

  • Tissue-specific roles: Different tissues show varying dependencies on Bak1 for apoptosis regulation, suggesting context-specific functions that remain to be fully characterized.

  • Post-translational modifications: How phosphorylation, ubiquitination, and other modifications regulate Bak1 activity in different cellular contexts is an active area of investigation.

  • Structural biology approaches: Advanced structural studies are revealing the conformational changes that occur during Bak1 activation and oligomerization, providing new targets for therapeutic intervention.

  • Intersection with other death pathways: The crosstalk between Bak1-mediated apoptosis and other cell death modalities (necroptosis, pyroptosis, ferroptosis) represents an important area for future research.

How might therapeutic targeting of Bak1 advance treatment of apoptosis-related diseases?

Therapeutic strategies targeting Bak1 hold promise for multiple conditions:

  • Cancer therapy: Approaches to activate Bak1 could overcome apoptotic resistance in cancer cells:

    • Direct Bak1 activators

    • Inhibitors of anti-apoptotic Bcl-2 family members

    • Combination approaches targeting both Bak1-dependent and independent pathways

  • Degenerative disorders: Inhibiting inappropriate Bak1 activation could protect cells in conditions characterized by excessive apoptosis:

    • Neurodegenerative diseases

    • Ischemia-reperfusion injury

    • Autoimmune disorders

  • Precision medicine approaches: Genetic profiling of Bak1 pathway components could guide treatment selection:

    • Tumors with specific Bcl-2 family expression patterns

    • Patients with polymorphisms affecting Bak1 regulation

    • Conditions with altered BIM expression or function

  • Novel therapeutic modalities: Emerging technologies could enable precise manipulation of Bak1:

    • Targeted protein degradation approaches

    • Gene editing to correct defects in Bak1 regulatory pathways

    • RNA therapeutics targeting Bak1 expression or splicing

What technological advances are needed to further elucidate Bak1's mechanisms of action?

Several technological developments would accelerate Bak1 research:

  • Advanced imaging tools:

    • Super-resolution microscopy to visualize Bak1 oligomerization in real-time

    • Cryo-electron tomography of Bak1-containing pores in native membranes

    • Multiplexed imaging to simultaneously track multiple Bcl-2 family proteins

  • Improved protein engineering:

    • Stabilized recombinant Bak1 variants for structural studies

    • Activity-based probes to monitor Bak1 activation status

    • Optogenetic tools to control Bak1 with spatiotemporal precision

  • Computational approaches:

    • Molecular dynamics simulations of Bak1 membrane insertion and pore formation

    • Systems biology models of the complete Bcl-2 family interaction network

    • AI-driven prediction of compounds that modulate Bak1 activity

  • Single-cell methodologies:

    • Single-cell proteomics to analyze Bak1 interaction networks

    • Live-cell reporters of Bak1 conformational status

    • Spatial transcriptomics to map Bak1 activity in tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.