Recombinant Mouse Bcl-2-like protein 13 (Bcl2l13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Bcl2l13; Mil1; Bcl-2-like protein 13; Bcl2-L-13; Bcl-rambo; Protein Mil1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASSTTASLGFHYETKYVVLSYLGLLSQEKQQGPSPPGVQLDVAPQSLNPEVLLKLKSEI EEELKTLDKEVSEAFTSTGFDCHTSPVFSPANPESSIEDCLAHLGERVSQDLKEPLQKAL QTILSQPVTYEAYRECTVETAVHASGWNKLLVPLVLLQHLLLELTRRGQEPLRMLLQFGV MYLEEHAAEFIIQQGGWGSVFSLEPEEEEYPGIIAEDSNDIYILPSDNSGQVSPPESPTV TTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSSGAGEKSENNSS NSDIVHVEKEEVPEEAFPGAAAPLLTQVPTVEAPEMMRAEKTSPTPSVFVELGEEELEAV TARPEAVERAEGAAQLSEERAGSRKKSHTGEAAAVRGAKSGLPAEGKAVLLFGGAAAVAI LAVAVGVALALRRK
Uniprot No.

Target Background

Function
May promote caspase-3 activation and apoptosis.
Gene References Into Functions
  1. MicroRNA-124 and microRNA-137 cooperatively control caspase-3 activity through BCL2L13 in hippocampal neural stem cells. PMID: 26207921
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Bcl2l13 and what are its primary functions?

Bcl2l13 (Bcl-2-like protein 13) is a member of the B cell lymphoma 2 (BCL-2) family with multiple cellular functions. It is ubiquitously expressed in mammalian cells and serves as a mitochondrial mitophagy receptor that mediates mitophagy and mitochondrial fragmentation . Research has identified Bcl2l13 as a mammalian homolog of yeast Atg32, playing a crucial role in mitochondrial quality control by binding to cleaved type II light chain 3 (LC3-II), the main component of the autophagosomal membrane . This binding allows mitochondria to be engulfed within autophagosomes.

Beyond mitophagy, Bcl2l13 has been identified as:

  • A critical regulator of adipogenesis that increases oxidative phosphorylation and suppresses apoptosis during adipocyte differentiation

  • An antiapoptotic protein in cancer contexts, particularly glioblastoma (GBM)

  • An inhibitor of ceramide synthases 2 and 6 (CerS2/6), contributing to therapy resistance in cancer

What is the genomic and structural organization of mouse Bcl2l13?

Mouse Bcl2l13 is located on chromosome 6. In C3H/HeJ mice, it is positioned approximately 9 kb downstream of the distal cut point of a unique chromosomal inversion that spans from 62 to 116 Mb on chromosome 6 . This positional context appears relevant to its expression patterns in different mouse strains.

Structurally, Bcl2l13 contains:

  • A Bcl-2 homology domain characteristic of the BCL-2 family

  • A membrane anchor domain

  • A unique C-terminal 250-amino acid sequence positioned between these two domains that mediates its interaction with ceramide synthases

The protein localizes primarily to mitochondria, where it executes its functions in mitophagy and apoptosis regulation.

How should researchers detect and quantify Bcl2l13 expression in experimental systems?

For accurate detection and quantification of Bcl2l13, researchers should employ multiple complementary approaches:

RNA expression analysis:

  • Real-time PCR (qPCR) using validated primers specific to mouse Bcl2l13

  • RNA-seq for transcriptome-wide expression analysis

Protein expression analysis:

  • Western blotting using validated antibodies against Bcl2l13

  • Immunofluorescence for localization studies

In published studies, researchers have effectively quantified Bcl2l13 by comparing its expression between different conditions. For example, during adipogenesis in BMSCs from C3H mice, Bcl2l13 showed a 2.7-fold increase in gene expression and a 2.6-fold increase in protein expression compared to BMSCs from B6 mice .

For temporal expression analysis during differentiation processes, measurement at multiple timepoints is recommended, as Bcl2l13 expression increases progressively during adipogenesis in parallel with adipocyte marker genes like Pparg and Adipoq .

What experimental models are most suitable for studying Bcl2l13 function?

Based on published research, the following experimental models have proven effective for studying Bcl2l13:

Cell culture models:

  • 3T3-L1 preadipocyte cell line for adipogenesis studies

  • Bone marrow stromal cells (BMSCs) isolated from mouse femurs

  • Mouse ear mesenchymal stem cells (eMSCs)

  • Glioblastoma cell lines for cancer-related studies

Mouse models:

  • C3H/HeJ mice (higher Bcl2l13 expression during adipogenesis)

  • C57BL6J mice (lower Bcl2l13 expression compared to C3H)

  • Mito-QC transgenic mice with mCherry-GFP tandem-tagged mitochondria for visualization of mitochondrial architecture and mitophagy

Comparative model systems:
Using BMSCs from different inbred mouse strains (C3H/HeJ vs. C57BL6J) has provided valuable insights into the genetic regulation of Bcl2l13 expression and its impact on differentiation capacity .

What are effective knockdown approaches for studying Bcl2l13 function?

RNA interference using small interfering RNA (siRNA) has been successfully employed to knockdown Bcl2l13 in multiple cell types:

Established protocols:

  • In 3T3-L1 cells, siRNA-mediated knockdown achieved approximately 90% reduction in Bcl2l13 expression after 3 days and 54% reduction after 6 days of adipogenic culture

  • In eMSCs, siRNA knockdown resulted in more than 75% reduction in both gene and protein levels after 6 days

Experimental considerations:

  • Include appropriate scramble siRNA controls

  • Validate knockdown efficiency at both mRNA (qPCR) and protein (Western blot) levels

  • Monitor for potential compensatory mechanisms in other mitophagy pathways (e.g., Bnip3, Pink1, Prkn2)

Researchers should note that Bcl2l13 knockdown significantly impairs adipocyte differentiation, alters mitochondrial dynamics, and affects cell viability, which may introduce confounding factors in experimental interpretation .

How can mitochondrial function be assessed in Bcl2l13 experimental studies?

Given Bcl2l13's role in mitochondrial function, the following methods have proven valuable:

Mitochondrial respiration:

  • Agilent XF Cell Mito Stress Test to measure oxygen consumption rate (OCR)

  • Extracellular acidification rate (ECAR) measurement to assess glycolytic activity

  • XFp glycolytic rate assay to quantify glycolytic ATP production

Mitochondrial content and dynamics:

  • Mitochondrial/nuclear DNA ratio (Mt/N) using qPCR to assess mitochondrial biogenesis

  • Western blotting for mitochondrial fusion protein MFN2 and fission protein DRP1

  • Analysis of phosphorylated DRP1 (serine 616 and 637) to assess fission activity

Mitophagy assessment:

  • Mito-QC transgenic mouse cells with mCherry-GFP tandem-tagged mitochondria

  • Quantification of mitophagy using ImageJ analysis of mCherry-positive red spots

  • Comparison of baseline mitophagy versus induced mitophagy using deferiprone (DFP)

ParameterMethodExpected Result in Bcl2l13 Knockdown
Oxygen consumptionXF Cell Mito Stress TestSignificantly lower OCR during adipogenic culture
Glycolytic activityECAR measurementHigher ECAR in both differentiation and non-differentiation conditions
ATP productionXFp glycolytic rate assayHigher glycolytic ATP production
Mitochondrial contentMt/N DNA ratioDecreased ratio during adipogenesis
Mitochondrial fusionMFN2 Western blotSignificant decrease
Mitochondrial fissionTotal DRP1 Western blotDecrease in total amount
MitophagymCherry-GFP imagingIncreased baseline mitophagy in non-differentiation culture

How does Bcl2l13 regulate adipocyte differentiation?

Bcl2l13 plays a crucial role in promoting adipogenesis through multiple mechanisms:

Metabolic programming:
Bcl2l13 supports the shift to oxidative phosphorylation required for adipocyte differentiation. During adipogenesis, Bcl2l13 expression increases progressively in a pattern similar to adipocyte marker genes (Pparg and Adipoq) . This increase is accompanied by:

  • Enhanced mitochondrial biogenesis (increased Mt/N ratio)

  • Increased mitochondrial fusion protein MFN2 expression

  • Higher oxygen consumption rate (OCR)

Functional evidence from knockdown studies:
Bcl2l13 knockdown in 3T3-L1 cells and eMSCs significantly impairs adipocyte differentiation as evidenced by:

  • Decreased Oil Red O staining

  • Reduced expression of adipocyte marker genes (Pparg, Fabp4, Adipoq)

  • Increased expression of preadipocyte marker gene Dlk1

Mitochondrial quality control:
Bcl2l13 appears to maintain mitochondrial quality during adipogenesis through balanced mitophagy. Interestingly, Bcl2l13 knockdown in eMSCs increased baseline mitophagy in non-differentiation culture , suggesting a complex regulatory role.

Apoptosis suppression:
Bcl2l13 prevents excessive apoptosis during adipogenic differentiation. Knockdown results in:

  • Decreased cell population during culture

  • Increased proportion of early apoptotic cells (Annexin V-positive, PI-negative)

What is the relationship between Bcl2l13 expression and metabolic programming in different cell types?

Bcl2l13 expression appears to correlate with metabolic programming, particularly in the context of cellular differentiation:

Strain-specific differences:

  • BMSCs from C3H/HeJ mice show higher Bcl2l13 expression during adipogenesis compared to C57BL6J mice (2.7-fold higher gene expression, 2.6-fold higher protein)

  • This correlates with enhanced adipogenic capacity in C3H BMSCs

Lineage-specific patterns:

  • Bcl2l13 expression increases significantly during adipogenesis but only slightly during osteogenesis

  • This pattern is consistent with the metabolic switch to oxidative phosphorylation required for adipocyte function, whereas osteoblasts primarily utilize glycolysis

Metabolic reprogramming following Bcl2l13 knockdown:
Bcl2l13 knockdown cells show:

  • Decreased oxygen consumption rate (OCR)

  • Increased extracellular acidification rate (ECAR)

  • Higher glycolytic ATP production

  • Reduced mitochondrial biogenesis (lower Mt/N ratio)

  • Decreased mitochondrial fusion protein MFN2

These findings suggest that Bcl2l13 plays a key role in determining whether cells utilize oxidative phosphorylation versus glycolysis to meet ATP demands, potentially influencing lineage determination and cell function.

How do genetic variations in Bcl2l13 affect its function in different mouse strains?

Genetic background significantly influences Bcl2l13 expression and function:

Strain-specific expression patterns:

  • C3H/HeJ mice show approximately 2.6-fold higher Bcl2l13 protein expression during adipogenesis compared to C57BL6J mice

  • This correlates with increased bone marrow adiposity in C3H/HeJ mice

Genomic context:

  • The Bcl2l13 gene in C3H/HeJ mice is located just 9 kb downstream of a unique chromosomal inversion on chromosome 6 (spanning 62-116 Mb)

  • This genomic context may influence its expression regulation

Congenic mouse studies:

  • Congenic B6.C3H.6T (6T) mice with C57BL6J genomic background but carrying the chromosomal 6 inversion from C3H/HeJ did not show increased adipogenesis unless exposed to a high-fat diet

  • This suggests that the genetic background of Bcl2l13 and the presence of proximal enhancers or repressors in the inverted chromosomal region collectively determine its expression and function

These findings highlight the importance of considering genetic background when studying Bcl2l13 function and suggest that its expression may be regulated by complex genetic interactions rather than simply by its coding sequence.

What mechanisms underlie Bcl2l13's function as a mitophagy receptor?

Bcl2l13 serves as a mitochondrial mitophagy receptor through specific mechanisms:

Molecular interactions:

  • Bcl2l13 has been identified as a mammalian homolog of yeast Atg32

  • It binds to cleaved type II light chain 3 (LC3-II), the main component of autophagosomal membranes

  • This binding facilitates mitochondrial engulfment within autophagosomes

Functional evidence:
Research using mito-QC mice (with mCherry-GFP tandem-tagged mitochondria) revealed complex regulation of mitophagy by Bcl2l13:

  • Unexpectedly, Bcl2l13 knockdown in eMSCs increased baseline mitophagy by 1.39-fold compared to control cells

  • Moreover, the addition of the mitophagy inducer deferiprone (DFP) led to a significant decrease of mitophagy in Bcl2l13 knockdown cells by 0.85-fold

Interaction with other mitophagy systems:
During adipogenesis, expression of genes associated with alternative mitophagy pathways showed various patterns:

  • Bnip3, Pink1, and Prkn2 significantly increased during adipogenesis

  • Bcl2l13 knockdown did not affect expression of Bnip3, Bnip3l, or Pink1

  • Only Prkn2 showed differential expression between Bcl2l13 knockdown and control cells

These findings suggest Bcl2l13 may serve as a quality control mechanism for mitophagy, potentially inhibiting excessive mitophagy under basal conditions while facilitating appropriate mitophagy during specific cellular processes like adipogenesis.

How does Bcl2l13 affect mitochondrial fusion and fission dynamics?

Bcl2l13 exerts significant effects on mitochondrial dynamics:

Effects on fusion machinery:

  • During adipogenesis, Bcl2l13 expression correlates with increased levels of mitochondrial fusion protein Mitofusin-2 (MFN2)

  • Bcl2l13 knockdown results in significant decrease of MFN2 levels

Effects on fission machinery:

Functional consequences:
These changes in mitochondrial dynamics proteins correlate with:

  • Decreased mitochondrial biogenesis (lower Mt/N ratio)

  • Impaired oxidative phosphorylation

  • Metabolic shift toward glycolysis

The data suggest that Bcl2l13 promotes mitochondrial fusion dynamics during adipogenesis, which aligns with the increased energy demands and metabolic shift toward oxidative phosphorylation required for adipocyte differentiation.

What role does Bcl2l13 play in cancer progression and therapy resistance?

Bcl2l13 functions as an antiapoptotic protein in cancer contexts with significant implications for therapy resistance:

Expression patterns:

  • Bcl2l13 shows elevated expression in solid and blood cancers, including glioblastoma (GBM)

  • It has been identified as a therapy susceptibility gene

Antiapoptotic mechanisms:

  • Mitochondria-associated Bcl2l13 inhibits apoptosis induced by various chemo- and targeted therapies

  • It acts upstream of Bcl2-associated X protein activation and mitochondrial outer membrane permeabilization

  • Bcl2l13 promotes GBM tumor growth in vivo

Ceramide synthase inhibition:
Bcl2l13 employs a unique mechanism to inhibit apoptosis in cancer cells:

  • It binds to proapoptotic ceramide synthases 2 (CerS2) and 6 (CerS6) via its unique C-terminal 250-amino acid sequence

  • This binding blocks homo- and heteromeric CerS2/6 complex formation and activity

  • CerS2/6 activity and Bcl2l13 abundance are inversely correlated in GBM tumors

Therapeutic implications:
The identification of Bcl2l13 as a ceramide synthase inhibitor provides:

  • A molecular explanation for low levels of proapoptotic ceramide species in high-grade gliomas

  • A potential target for therapeutic intervention to enhance cancer therapy efficacy

  • A mechanism to overcome therapy resistance in refractory cancers

How do reactive oxygen species (ROS) relate to Bcl2l13 function?

The relationship between Bcl2l13 and reactive oxygen species (ROS) has been investigated:

ROS production during adipogenesis:

  • During adipogenic differentiation, ROS-positive living cells increase significantly (approximately 3-fold) in both control and Bcl2l13 knockdown cells

  • This suggests that adipogenesis naturally involves increased ROS production regardless of Bcl2l13 status

Effects of Bcl2l13 knockdown on ROS:

  • In non-differentiation culture, Bcl2l13 knockdown cells showed a non-significant trend toward increased ROS (2.0-fold compared to control)

  • Despite the metabolic shift caused by Bcl2l13 knockdown, no significant changes in ROS production were observed

Mechanistic implications:
Research indicates that increased ROS is not responsible for the changes in mitochondrial activity observed in Bcl2l13 knockdown cells . This suggests that Bcl2l13's effects on mitochondrial function and cellular differentiation occur through mechanisms distinct from ROS regulation.

How can recombinant Bcl2l13 be used to study protein-protein interactions?

Recombinant mouse Bcl2l13 serves as a valuable tool for investigating protein-protein interactions in research settings:

Structural interaction studies:

  • Recombinant Bcl2l13 can be used to map the binding domains involved in its interaction with ceramide synthases (CerS2 and CerS6)

  • The unique C-terminal 250-amino acid sequence between Bcl2l13's Bcl-2 homology and membrane anchor domains is particularly relevant for these interactions

Functional domain analysis:

  • Structure-function studies using recombinant Bcl2l13 with specific domain mutations or deletions can help determine:

    • Which regions are essential for mitophagy receptor function

    • How the protein binds to LC3-II

    • The domains responsible for apoptosis regulation

In vitro binding assays:

  • Co-immunoprecipitation experiments with recombinant Bcl2l13 can confirm direct interactions with:

    • CerS2/6 complexes

    • Mitochondrial fusion/fission proteins (MFN2, DRP1)

    • Components of the autophagy machinery

Competitive binding experiments:

  • Recombinant Bcl2l13 can be used to develop inhibitors that block its interaction with ceramide synthases

  • Such studies could lead to therapeutic approaches for overcoming therapy resistance in cancers with high Bcl2l13 expression

What are emerging therapeutic strategies targeting Bcl2l13?

Based on the current understanding of Bcl2l13 function, several therapeutic strategies are under investigation:

Cancer therapy applications:

  • Targeting the Bcl2l13-CerS axis could enhance responses of therapy-refractory cancers to conventional and targeted regimens

  • Inhibiting Bcl2l13's binding to CerS2/6 may restore ceramide production and promote apoptosis in cancer cells

  • Reducing Bcl2l13 expression could potentially sensitize glioblastoma and other cancers to existing therapies

Metabolic disorder applications:

  • Modulating Bcl2l13 function might influence adipogenic differentiation and metabolic programming

  • This approach could have implications for bone marrow adiposity and related metabolic conditions

Potential approaches:

  • Small molecule inhibitors targeting the unique C-terminal domain of Bcl2l13

  • Peptide-based inhibitors that disrupt Bcl2l13-CerS interactions

  • RNA interference strategies to reduce Bcl2l13 expression in specific tissues

Research in this area remains ongoing, with the Bcl2l13-CerS axis representing a promising target for therapeutic intervention in multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.