Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1)

Shipped with Ice Packs
In Stock

Description

Introduction

Bcl-2-like protein 1 (Bcl2l1), also known as Bfl-1 or A1, is a member of the Bcl-2 family of proteins that regulate apoptosis . These proteins are crucial in controlling cell survival and death pathways, and their dysregulation is implicated in various diseases, including cancer . Recombinant Mouse Bcl-2-like protein 1 is a form of the protein produced using recombinant DNA technology, typically in bacterial or cell culture systems, for research purposes .

Production and Characteristics

Recombinant Mouse Bcl-2(1-203), which lacks the COOH-terminal hydrophobic tail, can be produced in bacterial inclusion bodies, solubilized, and refolded through dialysis, resulting in a monomeric protein in a nondenaturing solution . This recombinant protein has demonstrated activity in protecting mouse T hybridoma cells from glucocorticoid-induced apoptosis . Limited proteolysis experiments have identified a protease-sensitive region between the BH3 and BH4 homology domains of Bcl-2(1-203) .

Role in Cancer

Bcl2l1 is implicated in the development and progression of various cancers .

  • Anti-Apoptotic Function: As an anti-apoptotic protein, Bcl2l1 prevents programmed cell death, allowing cancer cells to survive and proliferate .

  • Overexpression and Amplification: Bcl2l1 is often overexpressed or amplified in cancer cells, contributing to their resistance to apoptosis . For example, amplification of BCL2L1 was detected in 10.7% of gastric cancer cases analyzed by aCGH .

  • Drug Resistance: Bcl2l1 can confer resistance to anticancer drugs. For instance, the β-catenin/BCL2L1 axis may play a vital role in cisplatin resistance .

  • Therapeutic Target: Given its role in cancer cell survival, Bcl2l1 is a potential therapeutic target. Inhibiting Bcl2l1 can promote apoptosis in cancer cells, either alone or in combination with other therapies .

Interactions and Inhibitors

Bcl2l1 interacts with other proteins in the Bcl-2 family, such as Mcl-1 and Bcl-xL, to regulate apoptosis .

  • Dual Inhibitors: Some compounds can inhibit multiple anti-apoptotic proteins simultaneously. For example, 2,5-substituted benzoic acid derivatives have been designed to bind to both Mcl-1 and Bfl-1, with some showing appreciable selectivity over Bcl-2/Bcl-xL . Compound 1 shows equipotent binding to both Mcl-1 and Bfl-1 proteins with 2- and 3-fold improvement, respectively, in comparison with 19SR .

  • Specific Inhibitors: BH3 mimetics, such as ABT-737, can inhibit Bcl2l1 and induce apoptosis, particularly in cells with BCL2L1 amplification .

Table 1. Binding affinities of 2,5-Substituted Benzoic Acid Derivatives to Mcl-1 and Bfl-1 Proteins

CompoundR1Mcl-1 Ki (μM)Bfl-1 Ki (μM)
11.5 ± 0.31.6 ± 0.2
2H47.8 ± 3.9>100
32.6 ± 0.43.0 ± 0.4
413.1 ± 2.414.8 ± 2.7
532.8 ± 4.9>70
64.7 ± 0.73.8 ± 1.1
770.4 ± 5.4>70
819.0 ± 1.262.0 ± 1.8
96.1 ± 1.010.6 ± 1.2
CompoundR2Mcl-1 Ki (μM)Bfl-1 Ki (μM)
10H3.4 ± 0.43.7 ± 0.4
112.7 ± 0.64.6 ± 0.5

Clinical Significance

The ATP1A1/BCL2L1 ratio is specifically associated with myelomonocytic and monocytic AML phenotypes . The combined ATP1A1/BCL2L1 ratio improves chemotherapeutic sensitivity prediction .

Regulation of BCL2L1 Expression

The methylation status of CpG sites within the BCL2L1 locus can affect its expression . For example, specific CpG sites at the exon 2 and intron 2 junction of the BCL2L1 locus are tightly correlated and may influence the response to MCL1 inhibitors in pediatric cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Bcl2l1; Bcl2l; Bclx; Bcl-2-like protein 1; Bcl2-L-1; Apoptosis regulator Bcl-X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Uniprot No.

Target Background

Function
A potent inhibitor of cell death, Bcl-2-like protein 1 (Bcl2l1) inhibits caspase activation. Its mechanism of action involves blocking the voltage-dependent anion channel (VDAC) by binding and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Furthermore, Bcl2l1 regulates the G2 checkpoint and cytokinesis during mitosis. The Bcl-X(L) isoform also modulates presynaptic plasticity, influencing neurotransmitter release and recovery, axonal mitochondrial number, and the size and number of synaptic vesicle clusters. During synaptic stimulation, it enhances mitochondrial ATP availability via regulation of mitochondrial membrane ATP synthase F(1)F(0) activity and regulates endocytic vesicle retrieval in hippocampal neurons through interaction with DMN1L and stimulation of its GTPase activity in synaptic vesicles. It may also attenuate inflammation by impairing NLRP1-inflammasome activation, thus inhibiting CASP1 activation and IL1B release. In contrast, the Bcl-X(S) isoform promotes apoptosis.
Gene References Into Functions
  1. Depletion of miR-34a enhanced endothelial cell growth and inhibited apoptosis in atherosclerosis (AS) by upregulating Bcl-2, suggesting a potential therapeutic target. PMID: 29704100
  2. BCL-XL promotes stemness and contributes to the aggressiveness of melanoma and glioblastoma. PMID: 29238043
  3. Treatment with the BH3 domain inhibitor BXI-72 significantly reduced synovial sarcoma cell growth and increased apoptotic signaling in both human and mouse models. PMID: 28851813
  4. GATA-3 facilitates bone fracture healing by regulating bcl-xL gene expression in conjunction with Runx2. PMID: 29170477
  5. Necrosis in Mycobacterium tuberculosis-infected macrophages is dependent on Bcl-xl activity. PMID: 28401933
  6. Mitochondrial Bcl-xL maintains mitochondrial respiratory capacity. Its deficiency leads to oxidative stress, increased glycolytic capacity, and compensatory upregulation of the pentose phosphate pathway. PMID: 28807815
  7. Proapoptotic proteins BIM and PUMA are not essential for reticulocyte apoptosis induced by BCL-XL loss. PMID: 28682312
  8. BMP4 promotes neural stem/progenitor cell survival by enhancing Bcl-xL's anti-apoptotic function via BMP4-Smad1/5/8-Id1 signaling in the presence of FGF-2. PMID: 29353044
  9. Bcl-xL is crucial for the survival of post-mitotic neurons during spinal cord development. PMID: 27665712
  10. Atherosclerosis-associated endothelial cell apoptosis may be partially caused by Bcl-Xl downregulation via miR-876 upregulation, which suppresses Bcl-Xl mRNA translation. PMID: 28723693
  11. Bcl-xL drives colorectal tumorigenesis and cancer progression. PMID: 27537525
  12. Mcl-1 is not essential for apoptosis regulation during large DNA virus infection, while Bcl-XL is important for maintaining the survival of infected cells. PMID: 27537523
  13. BCL-XL, BCL-2, and MCL-1 differentially regulate B-cell survival throughout development. PMID: 27560714
  14. Bcl-xL deficiency induced apoptosis in a specific neuronal population, leading to severe neurobehavioral abnormalities. PMID: 27194326
  15. PUMA loss does not affect BCL-XL-deficient platelet loss, suggesting other BH3-only proteins or alternative mechanisms may regulate platelet apoptosis. PMID: 27221652
  16. MLF1 is negatively regulated by 14-3-3, preventing Bcl-XL association and inhibiting apoptosis. PMID: 26563351
  17. Inhibition of BCL-W and BCL-XL selectively eliminates senescent cells. PMID: 27048913
  18. Valproic acid sensitized TRAIL-resistant papillary thyroid carcinoma cells to apoptosis via Nrf2 and Bcl-xL. PMID: 26721202
  19. Eosinophil survival is largely regulated by betac chain-induced NF-kappaB activation and subsequent Bcl-x induction. PMID: 25862560
  20. Beta-cell apoptosis is partially attributable to iPLA2beta-modulated bioactive lipids influencing Bcl-x pre-mRNA 5'SS selection. PMID: 25762722
  21. Loss of both Bclx alleles significantly inhibited tumorigenesis, while loss of a single Bim allele counteracted this effect. PMID: 24858047
  22. Only MCL-1, not BCL-XL, is critical for the development and sustained growth of p53-deficient thymic lymphoma. PMID: 25368374
  23. Plasma cell differentiation proceeds through a Bcl-xL-dependent intermediate, with cell death being C/EBP homologous protein (CHOP)-dependent, linking these events to the unfolded protein response (UPR). PMID: 25023286
  24. Bcl-xL regulates CD1d-mediated antigen processing and presentation to NKT cells by affecting the late endosomal compartment and CD1d localization. PMID: 25070854
  25. HAX-1 and BCL-XL have contrasting anti-apoptotic roles in cytokine-dependent bone marrow-derived cells. PMID: 24910348
  26. The IL-33/ST2 axis promotes mast cell survival via BCLXL. PMID: 24982172
  27. PP6 regulates apoptosis by modulating Bcl-xL Ser(62) phosphorylation, leading to polyubiquitination and degradation. PMID: 24808369
  28. A cardiac myocyte signaling cassette (K-Ras, RASSF1A, Mst1) promotes Mst1 activation in response to oxidative stress; activated Mst1 phosphorylates Bcl-xL, antagonizing Bcl-xL-Bax binding, activating Bax, and inducing apoptosis. PMID: 24813943
  29. The CD28 YMNM motif is critical for T cell proliferation and Bcl-xL expression. PMID: 24639356
  30. Bcl-xL blocks apoptosis from hypoxia/nutrient loss associated with NK cell-secreted IFN-gamma-mediated angiogenesis inhibition. PMID: 24313893
  31. Inositol trisphosphate receptors are unique K-Ras4B effectors that antagonize the pro-survival signals of other K-Ras effectors. PMID: 24297914
  32. Disrupting Bcl-xL:Bax binding rapidly induced apoptosis in neural progenitors and medulloblastoma cells. PMID: 24227720
  33. Bcl-xL interacts functionally with VDAC1 and -3, but not VDAC2. PMID: 23720737
  34. Cleavage-resistant Bcl-2 and Bcl-xL are more effective than their wild-type counterparts at inhibiting apoptosis in primary mouse T cells after T cell receptor cross-linking. PMID: 23203923
  35. In steatotic hepatocytes, the lack of voltage-dependent anion channel phosphorylation is associated with decreased interaction with glycogen synthase kinase 3 and Bcl-XL in mitochondria. PMID: 22814966
  36. Bcl-xL plays crucial anti-apoptotic roles in the megakaryocytic lineage, preventing lethal or severe spontaneous hemorrhage. PMID: 22790873
  37. Hesperetin inhibited xenograft growth by downregulating cyclin D1, CDK4, and Bcl-xL, and upregulating p57Kip2 in MCF-7 cells. PMID: 22209285
  38. Clusterin interacts with Bcl-xL in dying hippocampal CA3 neurons after seizures, while Bcl-xL levels remain constant. PMID: 22197644
  39. BCL-X is essential for retinal ganglion cell survival during differentiation. PMID: 22836101
  40. Endoplasmic reticulum-localized Bcl-x(L) affects Ca(2+) homeostasis but does not influence apoptosis unless present in other cellular compartments. PMID: 22573883
  41. Tanshinone IIA protects neurons from Abeta-induced cytotoxicity, likely via Bcl-xL pathway activation. PMID: 22498308
  42. Bcl-x(L) and Mcl-1 are essential for megakaryocyte lineage viability. PMID: 22374700
  43. Targeted Bcl-x deletion significantly impacts the entire macrophage population, modulating macrophage apoptosis resistance. PMID: 22383704
  44. Noxa and Bcl-xL co-regulate oxidative stress-induced apoptosis. PMID: 22380599
  45. Increased Bcl-x(L) may reflect impaired adaptation, potentially relevant to myeloproliferative disease mechanisms. PMID: 22086418
  46. Down syndrome model mice exhibit hippocampal Bcl-X(L) downregulation. PMID: 21684326
  47. Patients with Lnk/Sh2b3 mutations may exhibit apoptosis resistance in hematopoietic stem cells due to thrombopoietin-mediated Bcl-xL upregulation. PMID: 22101255
  48. Bcl-xL is crucial for lymphomagenesis in c-Myc overexpressing mice, unlike Bcl-2. PMID: 21998213
  49. EVI1 directly induces Bcl-xL expression via its zinc finger domains, inhibiting apoptosis. PMID: 21980434
  50. Hrk deficiency does not significantly reduce apoptosis in the Bcl-x (-/-) embryonic nervous system, indicating other BH3-only molecules may regulate BAX activation in immature neurons. PMID: 22043021
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.; [Isoform Bcl-X(delta-TM)]: Cytoplasm.
Tissue Specificity
Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.