Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3)

Shipped with Ice Packs
In Stock

Description

Molecular Functions

Bnip3 regulates apoptosis and mitochondrial integrity through:

  • Apoptosis induction: Overrides BCL2-mediated suppression via BH3 domain interactions .

  • Calcium regulation: Modulates intracellular calcium storage compartments with BCL2 .

  • Mitochondrial quality control: Partners with SPATA18/MIEAP and BNIP3L/NIX to mediate lysosomal protein translocation during mitochondrial damage (MALM process) .

Research Applications

This recombinant protein is instrumental in:

  • Hypoxia studies: BNIP3 upregulation under hypoxia triggers caspase-independent cell death via apoptosis-inducing factor (AIF) nuclear translocation .

  • Cancer therapy: Overexpression enhances radiosensitivity in cervical cancer models, reducing tumor viability (p < 0.01) .

  • Protein interaction assays: Binds BCL2, BCL-XL, and SPATA18 to study mitochondrial pore dynamics .

Table 2: Functional Studies Involving Recombinant Mouse Bnip3

Study FocusKey FindingsModel SystemReference
Hypoxia-induced deathBNIP3 activates AIF-mediated caspase-independent apoptosisNeural cells
Mitochondrial poreSPATA18/BNIP3 complex enables lysosomal protein translocationIn vitro
RadiosensitizationBNIP3 plasmid transfection enhances HeLa cell apoptosis post-radiationCervical cancer

Experimental Considerations

  • Storage: Stable at -80°C with 50% glycerol; avoid freeze-thaw cycles .

  • Activity: Functional assays require validated mitochondrial localization .

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol.

Note: Specify your desired glycerol concentration in order notes if different from the default.

For lyophilized powder delivery, the buffer prior to lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Description

This recombinant Mouse Bnip3 protein is a full-length protein expressed in vitro using an E. coli cell-free system. Purity is ≥85%, as determined by SDS-PAGE. Cell-free protein expression leverages whole-cell extracts containing all necessary components for transcription, translation, and post-translational modification (including RNA polymerase, regulatory and transcription factors, ribosomes, and tRNA). Supplementation with cofactors, nucleotides, and the target gene template enables efficient protein synthesis within hours.

Bnip3, a pro-apoptotic BH3-only protein of the Bcl-2 family, is implicated in apoptosis, programmed necrosis, autophagy, and mitophagy in cells and tissues subjected to hypoxia or ischemia. Beyond its role in cell death and metastasis, Bnip3 modulates various metabolic pathways, including lipid metabolism, glycolysis, and mitochondrial bioenergetics. Furthermore, Bnip3 plays a significant role in carcinogenesis; its upregulated expression is observed in lung, prostate, cervical, and breast cancers, correlating with aggressive tumor phenotypes and poor prognoses.

Form
Liquid or Lyophilized powder

Note: We will ship the available format. Specify your preferred format in order notes for customized preparation.

Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Bnip3; Nip3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Datasheet & Coa
Please contact us to get it.
Expression Region
1-187aa
Mol. Weight
23.8 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

Bnip3 is an apoptosis-inducing protein capable of overcoming Bcl-2 suppression. It may play a role in intracellular calcium repartitioning between major stores in association with Bcl-2. Bnip3 participates in mitochondrial quality control through interaction with SPATA18/MIEAP, contributing to mitochondrial protein catabolic processes (MALM) leading to the degradation of damaged mitochondrial proteins. The interaction of SPATA18/MIEAP, Bnip3, and Bnip3L/Nix at the mitochondrial outer membrane is critical for translocating lysosomal proteins from the cytoplasm to the mitochondrial matrix, regulating pore formation in the mitochondrial double membrane to facilitate this translocation. Bnip3 also plays a significant role in the calprotectin (S100A8/A9)-induced cell death pathway.

Gene References Into Functions
  1. High-fat-mediated liver damage is associated with Sirt3 downregulation, subsequent ERK-CREB pathway inactivation, and Bnip3-mediated inhibition of mitophagy, resulting in mitochondria-dependent hepatocyte death. PMID: 30056271
  2. JNK activates Mff and Bnip3, contributing to mitochondrial fission and mitophagy, respectively. PMID: 29149759
  3. BNIP3 expression is upregulated in hypoxic keratinocytes, and BNIP3 silencing suppresses hypoxia-induced cell migration. PMID: 27783443
  4. In a neuronal model of dominant optic atrophy, BNIP3 downregulation reduced autophagy and mitophagy. PMID: 27861891
  5. Olomoucine, a cyclin-dependent kinase inhibitor, downregulates Bnip3, reducing lipopolysaccharide- and nitric oxide-induced cell death in BV2 microglial cells by limiting proinflammatory responses and nitric oxide generation. PMID: 27345388
  6. Data suggest Bnip3 as a key effector of PPARγ-mediated adipose mitochondrial network fragmentation, improving insulin sensitivity and limiting oxidative stress. PMID: 27325287
  7. BNIP3 regulates PINK1 mitochondrial outer membrane localization, PINK1 proteolysis, and PINK1/parkin-mediated mitophagy under physiological conditions. PMID: 27528605
  8. BNIP3 interacts directly with the mitochondrial outer membrane via mitochondrial BAX. PMID: 28333095
  9. TGFβ-activated kinase-1 (TAK1) activates NFAT/NF-κB, downregulates Bnip3, and inhibits cardiac cell death. PMID: 26564789
  10. BNIP3 acts as a brake on HIF-1 activity, increasing mitophagy rates in response to hypoxia and limiting the production of damaging ROS, thereby limiting tumor progression to metastasis. PMID: 26232272
  11. Bnip3 regulates cardiac gene expression and myocyte morphology by activating nuclear p300 acetyltransferase and hyperacetylating histones and selective transcription factors. PMID: 26317696
  12. Bnip3 demonstrates dual functionality and crosstalk between mitophagy and apoptosis pathways. PMID: 26253153
  13. BNIP3 regulates mitophagy during hypoxia, while NIX is required for mitophagy during erythroid lineage development. PMID: 25753537
  14. BNIP3 plays a role in generating robust NK cell memory through mitophagy during viral infection. PMID: 26253785
  15. BNIP3 primarily regulates basal mitophagy levels under physiological conditions, while exclusively activating excessive mitophagy leading to cell death. PMID: 25230377
  16. PARP1-mediated Bnip3 generation causes mitochondrial damage and neuronal death. PMID: 25429139
  17. BNIP3 exhibits a pro-tumorigenic role, driving aggressive features in melanoma cells, such as migration and vasculogenic mimicry. PMID: 24625986
  18. BNIP3 has a protective effect against UVB-induced apoptosis in keratinocytes. PMID: 24402046
  19. The BNIP3 cell death pathway may be a target for protecting oligodendrocytes from post-stroke death. PMID: 23692407
  20. Bnip3 is a required downstream effector of FoxO-driven autophagic flux in mechanically unloaded failing myocardium. PMID: 23568341
  21. Cavitation occurs through hypoxia-induced apoptosis of core cells mediated by HIFs, Bnip3, and AIF. PMID: 22753893
  22. Loss of BNIP3 results in increased hepatic lipid synthesis, elevated ATP levels, reduced AMPK activity, and increased lipogenic enzyme expression. PMID: 22547685
  23. A mouse model demonstrates a balance between BNIP3-mediated autophagy and H-ras(val12)-induced tumor formation, with H-ras(val12) inducing autophagy in a BNIP3-dependent manner. PMID: 22241963
  24. HIF-1α and BNIP3 are involved in hypoxia-induced autophagy activation and osteoclastogenesis. PMID: 21465467
  25. NOV and BNIP3 expression is significantly higher in leukemia AML-M(4) than in normal controls. PMID: 21518474
  26. Bnip3 regulates hypoxia-induced autophagy, involving Drp1-mediated mitochondrial fission and Parkin recruitment. PMID: 21890690
  27. Enforced and endogenous Ras expression coincides with Bnip3 upregulation across various cancer cells, indicating Bnip3 as an H-Ras regulatory target. PMID: 21868531
  28. Bnip3 increases mitochondrial protease activity, suggesting a role in mitochondrial protein degradation. PMID: 21278801
  29. Alternative splicing of Bnip3FL during hypoxia or ischemic stress is linked to a defense mechanism against mitochondrial defects and cardiomyocyte death. PMID: 21415393
  30. MAFbx and Bnip3 expression is increased in the hearts of mice with colonic tumors. PMID: 21167183
  31. Bnip3 mediates mitochondrial permeabilization via a mechanism distinct from other BH3-only proteins. PMID: 20025887
  32. Bnip3 is important in the cardiomyocyte death pathway following severe hypoxia. PMID: 20160671
  33. PLAGL2 expression leads to the mRNA expression of the proapoptotic factor Nip3. PMID: 11832486
  34. The region between -281 and -1 of the 5'-upstream enhancer region of murine BNIP3 is sufficient for nitric oxide-dependent BNIP3 expression. PMID: 15358175
  35. Bnip3-mediated upregulation of autophagic activity constitutes a protective response against Bnip3 death signaling. PMID: 16874059
  36. BNIP3 regulates hypoxia-induced autophagy, and the RB tumor suppressor prevents nonapoptotic cell death by limiting BNIP3 induction. PMID: 17576813
  37. Bnip3/Bnip3L play a crucial role in anthrax lethal toxin-induced cytotoxicity, and their downregulation is a mechanism of spontaneous or toxin-induced macrophage resistance. PMID: 17623653
  38. Bnip3 may promote cell survival by preventing ATP depletion or eliminating damaged mitochondria. PMID: 17786027
  39. Bnip3 minimizes ventricular remodeling in mice. PMID: 17909626
  40. BNIP-3 is a candidate intrinsic factor related to antidepressive effects. PMID: 18606473
  41. Hepatic BNIP3 is upregulated in models of in vivo liver stress. PMID: 19147804
  42. Chronic intermittent hypoxia upregulates Nip3, resulting in neuronal apoptosis and ultrastructural changes in the frontal cortex. PMID: 19187620
  43. Cell injury/death may result from Bnip3 upregulation or SP-C-induced endoplasmic reticulum stress. PMID: 19574421
  44. BNIP3 regulates caspase-independent neural precursor cell death after hypoxia. PMID: 19915483
Database Links
Protein Families
NIP3 family
Subcellular Location
Mitochondrion. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is BNIP3 and what are its key structural features?

BNIP3 (BCL2 and adenovirus E1B 19-kDa-interacting protein 3) is a protein with homology to BCL2 in the BH3 domain that induces both cell death and autophagy. It was initially identified in a yeast two-hybrid screen as a BCL2 and adenovirus E1B 19-kDa-interacting protein . Structurally, BNIP3 contains a putative BH3 domain and a C-terminal transmembrane domain, with the latter being essential for mitochondrial localization and proapoptotic activity . The BNIP3 BH3 domain differs from the consensus BCL2 family sequence at two evolutionarily conserved residues (W7 and W11), which may contribute to its unique functional properties . The transmembrane domain plays a critical role in the interaction of BNIP3 with BCL2 or BCL-XL and is crucial for BNIP3-induced cell death .

How does recombinant mouse BNIP3 compare to endogenous BNIP3?

Recombinant mouse BNIP3, typically produced in E. coli expression systems, has a molecular weight of approximately 17.1 kDa and often includes an N-terminal His Tag to facilitate purification . The recombinant protein maintains the functional domains of endogenous BNIP3 but may lack post-translational modifications that occur in mammalian cells. When working with recombinant BNIP3, researchers should be aware that the protein is typically supplied in lyophilized form from a 0.2 μm filtered solution in 10 mM Hepes, 500 mM NaCl with 5% trehalose at pH 7.4 . For experimental applications, proper reconstitution is critical – this involves centrifuging the vial at 10,000 rpm for 1 minute and then reconstituting at 200 μg/ml in sterile distilled water by gentle pipetting 2-3 times, avoiding vortexing which can disrupt protein structure .

What experimental applications is recombinant mouse BNIP3 suitable for?

Recombinant mouse BNIP3 is primarily used in ELISA (Enzyme-Linked Immunosorbent Assay) and Western Blotting applications . For ELISA, the recombinant protein can serve as a standard for quantification or as an antigen in direct or indirect ELISA formats. In Western Blotting applications, researchers often use recombinant BNIP3 as a positive control to validate antibody specificity and to determine the molecular weight of native BNIP3 in experimental samples. The high purity (>95% as determined by SDS-PAGE) of commercially available recombinant BNIP3 makes it suitable for these analytical techniques . Additionally, recombinant BNIP3 can be utilized in functional assays investigating mitophagy induction, apoptosis pathways, or protein-protein interactions with BCL2 family members.

What is the relationship between BNIP3 and mitophagy?

BNIP3 plays a crucial role in the regulation of mitophagy, a specialized form of autophagy targeting mitochondria for elimination. In response to hypoxia, BNIP3 expression increases and promotes the sequestration of damaged or dysfunctional mitochondria into autophagosomes . The process begins with BNIP3 localization to the outer mitochondrial membrane, where it can interact with LC3, a key component of the autophagosome machinery . This interaction facilitates the engulfment of mitochondria by autophagosomes, which subsequently fuse with lysosomes for degradation. The role of BNIP3 in mitophagy is particularly important during cellular stress conditions, as it helps maintain mitochondrial quality control by eliminating damaged organelles . Research has demonstrated that BNIP3-mediated mitophagy can be neuroprotective, suggesting that the process serves as a survival mechanism rather than solely contributing to cell death .

How does BNIP3-mediated mitophagy influence neuronal aging and organismal health?

BNIP3-mediated mitophagy plays a significant role in counteracting age-related decline in neuronal function and organismal health. Research has demonstrated that aging leads to a decline in mitophagy in the brain, but neuronal induction of BNIP3 can improve mitochondrial homeostasis in aged brains . In experimental models, adult neuronal BNIP3 induction resulted in significantly longer lifespans compared to controls, and even midlife neuronal BNIP3 induction was sufficient to extend maximum lifespan . Conversely, knockdown of BNIP3 through RNAi expression ubiquitously or specifically in neurons resulted in shortened lifespans .

The neuroprotective effects of BNIP3-mediated mitophagy are evident in the structural preservation of brain tissue. BNIP3 induction counteracted the loss of brain nuclei detected in age-matched controls and was associated with fewer apoptotic cells in the aged brain, as detected by cleaved caspase-3 staining . Mechanistically, neuronal induction of BNIP3 results in significantly more mitolysosomes (structures formed during mitophagy when autophagosomes containing mitochondria fuse with lysosomes) compared to controls, indicating enhanced mitochondrial quality control . These findings suggest that targeted induction of BNIP3-mediated mitophagy represents a potential intervention strategy to counteract age-related neurodegeneration and extend healthy lifespan.

What are the biophysical properties of the BNIP3 transmembrane domain and how do they contribute to its function?

The transmembrane domain of BNIP3 exhibits unique biophysical properties that are essential for its function in cell death and mitophagy. BNIP3 undergoes homodimerization in cells, which is resistant to denaturation by sodium dodecyl sulfate (SDS) or reducing conditions and is mediated by its transmembrane domain . Biophysical studies have revealed that the BNIP3 transmembrane domain strongly self-associates in Escherichia coli membranes and SDS micelles, forming dimers with a right-handed parallel helix–helix structure that creates a continuous hydrophilic track spanning the lipid bilayer .

The critical interfacial residues that mediate BNIP3 homodimerization follow the pattern S172H173XXA176XXL179G180XXI183G184 (numbers from human BNIP3) . These residues are conserved between BNIP3 and NIX (another related protein) and include an AXXXGXXXG glycine zipper motif . Specific interactions, such as intermonomeric hydrogen bonds between polar residues at S172 and H173, contribute to the stability of the dimer structure . It has been proposed that the residues S172 and H173 control an acid-sensitive proton channel in the mitochondrial outer membrane that can initiate cell death, although experimental results with an H173A mutant of BNIP3 have been inconsistent . The structural arrangement of the transmembrane domain is crucial for BNIP3 function, as it may facilitate the formation of pores or channels in the mitochondrial membrane, contributing to mitochondrial permeability transition and subsequent cell death or mitophagy.

How does BNIP3 contribute to cisplatin resistance in cancer cells and what are the implications for targeted therapies?

What methodological approaches are most effective for studying BNIP3-mediated mitophagy in different experimental systems?

Several methodological approaches can be employed to study BNIP3-mediated mitophagy, with the optimal techniques depending on the specific research questions and experimental systems. For in vitro studies, fluorescence microscopy with mitochondrial markers and autophagy markers (such as LC3) provides valuable insights into the process of mitophagy. Specifically, co-localization of mitochondrial markers with lysosomal markers or LC3-positive autophagosomes indicates ongoing mitophagy. For quantitative assessment, researchers can use mitolysosome quantification techniques to count structures formed when autophagosomes containing mitochondria fuse with lysosomes .

For in vivo studies, genetic models with inducible expression systems offer powerful tools. For example, researchers have used the elavGS-GAL4 system to induce BNIP3 expression specifically in neurons at different life stages . This approach allowed them to demonstrate that even midlife induction of BNIP3 (for one or two weeks) was sufficient to increase the number of mitolysosomes in aged brains and extend maximum lifespan .

Biochemical approaches, including immunoprecipitation and western blotting, can be used to analyze BNIP3 protein interactions and post-translational modifications. Additionally, assessing mitochondrial function through measurements of membrane potential (ΔΨm), respiratory capacity, and ATP production provides valuable information about the consequences of BNIP3-mediated mitophagy. Combining these approaches with genetic manipulation techniques, such as CRISPR-Cas9 gene editing or RNAi knockdown , enables comprehensive investigation of BNIP3 function in different contexts.

What are the optimal storage and handling conditions for recombinant mouse BNIP3?

Proper storage and handling of recombinant mouse BNIP3 are critical for maintaining its biological activity and ensuring experimental reproducibility. According to established protocols, lyophilized recombinant BNIP3 should be stored at -20°C for up to 12 months . After reconstitution, the protein should be stored at 2-8°C for up to 1 month under sterile conditions . To prevent protein degradation, it is advisable to aliquot the reconstituted protein and avoid repeated freeze-thaw cycles.

When handling recombinant BNIP3, researchers should follow specific reconstitution procedures: centrifuge the vial at 10,000 rpm for 1 minute, reconstitute at 200 μg/ml in sterile distilled water by gentle pipetting 2-3 times, and importantly, avoid vortexing which can disrupt protein structure . For experimental applications, it may be necessary to dilute the reconstituted protein in appropriate buffers depending on the specific assay requirements. Additionally, researchers should verify protein integrity via SDS-PAGE before use, especially if the reconstituted protein has been stored for an extended period.

How can researchers experimentally distinguish between BNIP3-induced mitophagy and apoptosis?

Distinguishing between BNIP3-induced mitophagy and apoptosis is crucial for interpreting experimental results correctly. These processes can occur simultaneously or sequentially, making their differentiation challenging. Several experimental approaches can help researchers make this distinction:

  • Temporal analysis: Mitophagy often precedes apoptosis, so time-course experiments can help determine the sequence of events. By examining cells at multiple time points after BNIP3 induction, researchers can observe whether mitophagy markers appear before apoptotic markers.

  • Specific markers: Mitophagy can be detected using co-localization of mitochondrial markers (MitoTracker, TOM20) with autophagy markers (LC3, LAMP1), while apoptosis can be assessed using markers such as cleaved caspase-3, PARP cleavage, or Annexin V staining . Quantification of mitolysosomes is particularly useful for assessing mitophagy levels .

  • Pharmacological interventions: Using autophagy inhibitors (such as bafilomycin A1 or chloroquine) or apoptosis inhibitors (z-VAD-fmk) can help determine which process is primarily responsible for observed phenotypes. If blocking autophagy prevents certain BNIP3 effects while apoptosis inhibitors do not, this suggests mitophagy is the predominant mechanism.

  • Genetic approaches: Creating mutations in the BNIP3 protein that selectively disrupt either its mitophagy-inducing or apoptosis-inducing functions can help delineate these pathways. For instance, mutations in the transmembrane domain might affect both functions, while mutations in other regions might selectively impact one process .

  • Electron microscopy: Ultrastructural analysis using transmission electron microscopy can directly visualize mitophagic vesicles (autophagosomes containing mitochondria) as well as apoptotic changes such as chromatin condensation and membrane blebbing.

What are the key experimental controls needed when studying BNIP3 function in different model systems?

When studying BNIP3 function, implementing appropriate experimental controls is essential for generating reliable and interpretable data. The following controls should be considered:

  • Expression controls: When inducing BNIP3 expression, parallel experiments should include expression of non-functional BNIP3 mutants or unrelated proteins (such as GFP) to control for effects of protein overexpression . For example, adult induction of GFP in neurons failed to prolong lifespan in fly models, confirming that lifespan extension was specific to BNIP3 induction .

  • Physiological controls: Changes in BNIP3 expression might affect basic physiological parameters. For instance, in studies of BNIP3's effect on lifespan, it's important to control for potential changes in feeding behavior, which researchers have assessed using methods like the Con-Ex feeding assay .

  • Genetic background controls: When using genetic models (knockouts, transgenics), appropriate wild-type controls of the same genetic background are essential, as background differences can significantly impact experimental outcomes.

  • Tissue/cell type-specific controls: The effects of BNIP3 can vary across different tissues or cell types. For instance, while neuronal BNIP3 induction extended lifespan in flies, it's important to compare these effects with BNIP3 induction in other tissues to determine tissue-specific roles .

  • Autophagy dependency controls: Since BNIP3 functions in mitophagy, experiments should include controls that block the autophagy pathway (pharmacologically or genetically) to confirm that observed effects are autophagy-dependent .

  • Age and developmental stage controls: BNIP3 functions can vary with age or developmental stage. Research has shown that even midlife induction of BNIP3 was sufficient to extend maximum lifespan , highlighting the importance of age-matched controls and temporal regulation of BNIP3 expression.

How might BNIP3-mediated mitophagy be therapeutically modulated to address age-related neurodegenerative diseases?

The discovery that BNIP3-mediated mitophagy can improve neuronal health and extend lifespan opens promising avenues for therapeutic interventions in age-related neurodegenerative diseases. Research has demonstrated that neuronal induction of BNIP3, even at midlife, resulted in flies with significantly longer lifespans compared to controls and was sufficient to extend maximum lifespan . These findings suggest that enhancing BNIP3-mediated mitophagy could potentially slow or reverse aspects of neurodegeneration associated with aging.

Several approaches could be explored to therapeutically modulate BNIP3-mediated mitophagy. Pharmacological agents that selectively increase BNIP3 expression or activity in neurons might enhance mitochondrial quality control and protect against age-related decline. Alternatively, gene therapy approaches could be developed to deliver BNIP3 specifically to neurons in affected brain regions. The temporal aspect of intervention is particularly important, as research indicates that even late-life induction of BNIP3 can provide benefits , suggesting that therapeutic intervention might be effective even after disease onset.

What is the cross-talk between BNIP3 and other autophagy/mitophagy regulators?

The interplay between BNIP3 and other autophagy/mitophagy regulators represents a complex regulatory network that fine-tunes cellular responses to various stressors. One significant interaction involves BNIP3, BCL2/BCL-XL, and Beclin-1. Both BNIP3 and Beclin-1 were initially identified as BCL2- or BCL-XL-interacting proteins . Beclin-1 is part of a class III PI3-K-containing complex that regulates autophagy induction, and BCL2 inhibits autophagy by binding to Beclin-1 through a BH3-like domain in Beclin-1 . It has been proposed that BNIP3 might compete with Beclin-1 for binding to BCL-XL, thereby releasing Beclin-1 and activating autophagy .

Another area of cross-talk involves the relationship between BNIP3-mediated mitophagy and the PINK1/Parkin pathway, which represents another major mechanism for mitophagy induction. While these pathways are often studied separately, emerging evidence suggests they may operate in parallel or even cooperatively under certain conditions. Understanding how these pathways interact or compensate for each other is crucial for developing comprehensive approaches to modulating mitophagy for therapeutic purposes.

BNIP3 may also interact with broader cellular stress response pathways, including those regulated by hypoxia-inducible factors (HIFs) and p53. BNIP3 is regulated by hypoxia in tumor cells , suggesting coordination between oxygen sensing mechanisms and mitochondrial quality control. Additionally, the relationship between BNIP3-mediated mitophagy and mitochondrial biogenesis pathways represents an important area for investigation, as maintaining mitochondrial homeostasis requires balancing removal of damaged mitochondria with generation of new ones. Unraveling these complex interactions will provide deeper insights into how cells maintain mitochondrial health and may reveal new targets for therapeutic intervention in diseases associated with mitochondrial dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.