Recombinant Mouse Bestrophin-1 (Best1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with normal blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
Best1; Bmd1; Vmd2; Bestrophin-1; Vitelliform macular dystrophy protein 2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Best1
Target Protein Sequence
MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQL LFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEE GRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNT FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVV TVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGE DDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYWNEAAPQPPYTAASARSRRHSFM GSTFNISLKKEDLELWSKEEADTDKKESGYSSTIGCFLGLQPKNYHLPLKDLKTKLLCSK NPLLEGQCKDANQKNQKDVWKFKGLDFLKCVPRFKRRGSHCGPQAPSSHPTEQSAPSSSD TGDGPSTDYQEICHMKKKTVEFNLNIPESPTEHLQQRRLDQMSTNIQALMKEHAESYPYR DEAGTKPVLYE
Uniprot No.

Target Background

Function
Bestrophin-1 (Best1) forms calcium-sensitive chloride channels that are permeable to bicarbonate.
Gene References Into Functions

Functions of Bestrophin-1

  1. Studies indicate that the ion channels CaV1.3, bestrophin-1 and maxiK play a role in regulating photoreceptor outer segments (POS) phagocytosis by the retinal pigment epithelium (RPE). PMID: 26427483
  2. Best1-mediated astrocytic glutamate activates the synaptic N-methyl-D-aspartate receptor (NMDAR) and modulates NMDAR-dependent synaptic plasticity. PMID: 25645137
  3. Bestrophin-1 functions as an intracellular Cl channel facilitating the accumulation and release of Ca(2+) from stores by conducting the counterion for Ca(2+). PMID: 24664688
  4. Best1, located at the microdomains near the synaptic junctions, exhibits significantly high permeability to glutamate in vivo. PMID: 24321245
  5. Findings indicate that different mutations in Best1 cause differential effects on its localization, and this effect varies depending on the presence or absence of wild-type (WT) Best1. PMID: 23825107
  6. Astrocytic glutamate via Best1 channel targets and activates synaptic NMDA receptors. PMID: 23324492
  7. Upon activation of protease activated receptor 1 (PAR1), an increase in intracellular Ca2+ concentration leads to the opening of Best1 channels and subsequent release of glutamate in cultured astrocytes. PMID: 23062602
  8. Ultrastructural analyses reveal that TREK-1 is preferentially localized at cell body and processes, whereas Best1 is mostly found in microdomains of astrocytes near synapses. PMID: 23021213
  9. A study reports that tonic inhibition in the cerebellum is due to GABA being released from glial cells by permeation through the Bestrophin 1 anion channel PMID: 20929730
  10. Retinal pigment bestrophin-1 likely conducts Cl(-) as a counterion for Ca(2+) uptake into cytosolic Ca(2+) stores. PMID: 20411394
  11. Data show that bestrophin 1 is localized in the endoplasmic reticulum (ER), where it interacts with the ER-Ca(2+) sensor and can enhance Ca(2+) signaling and activation of Ca(2+)-dependent Cl(-) (TMEM16A) and K(+) (SK4) channels. PMID: 19823864
  12. Cloning and characterization were achieved by combining biocomputational analyses and molecular genetic approaches PMID: 15218265
  13. We hypothesize that the loss of vision associated with Best vitelliform macular dystrophy is not caused by the same pathologic process as the diminished light peak, but is caused by an unidentified effect of best-1 [VMD2] on other cellular processes. PMID: 16636205
  14. BEST1 may form the Ca2+-activated Cl(-) current, or it may be a component of a Cl(-) channel complex in epithelial tissues. PMID: 17003041
  15. Studies suggest a role of bestrophin 1 and 2 for Ca(2+) dependent Cl(-) secretion in mouse airways PMID: 18652850
  16. This study provides the first characterization of the biophysical properties of mBest1 and a framework for elucidating the physiological role of bestrophins. PMID: 19426717
  17. Repression of cell proliferation, induction of Ca(2+)-dependent Cl(-) conductance, and expression of Best1 occur during mesenchymal-to-epithelial transition once renal collecting duct cells polarize and terminally differentiate. PMID: 19470678
  18. Our data suggest that Best1 belongs to a group of genes upregulated by nerve injury and supports functional Ca(2+)-activated chloride current expression in injured sensory neurons PMID: 19675239
  19. The data of this study provided molecular evidence that the Bestrophin-1 channel is responsible for Ca2+-activated anion channel function in astrocytes. PMID: 19828819
Show More
Hide All
Database Links
Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.

Q&A

What is the functional role of Best1 in mouse models?

Mouse Bestrophin-1 functions primarily as a Ca²⁺-activated and volume-regulated chloride channel, similar to its human counterpart. In mouse models, Best1 is expressed predominantly in retinal pigment epithelium (RPE) cells where it plays a critical role in maintaining fluid and electrolyte homeostasis between the RPE and photoreceptor outer segments. Interestingly, Best1 also shows significant expression in testis, where mutations can affect sperm motility and fertility, providing an additional phenotype for studying Best1 function . When designing experiments with recombinant mouse Best1, researchers should consider these tissue-specific roles to properly interpret results.

How do mouse and human Best1 proteins compare structurally and functionally?

Mouse and human Best1 share significant structural homology, making mouse models valuable for studying human Best1-related diseases. Both function as calcium-activated chloride channels with similar activation mechanisms. For researchers working with recombinant proteins, it's important to note that while the core channel functions are conserved, there may be species-specific differences in regulation, protein interactions, or tissue expression patterns. When conducting patch clamp experiments, recombinant mouse Best1 exhibits Ca²⁺-dependent Cl⁻ currents similar to human BEST1, though possibly with different activation thresholds or kinetics . Homology models can be generated using crystal structures (such as the chicken BEST1 structure) to predict structural features of mouse Best1 .

What expression systems are suitable for producing recombinant mouse Best1?

Several expression systems have been validated for producing functional recombinant mouse Best1. HEK293 cells represent a commonly used heterologous system for expressing and testing Best1 variants, as demonstrated in multiple studies . For more physiologically relevant systems, human pluripotent stem cells (hPSCs) differentiated into RPE cells can express recombinant Best1. Baculovirus expression systems have also proven effective, particularly when using BacMam baculovirus for mammalian cell transduction . When selecting an expression system, researchers should consider whether their experimental goals require native post-translational modifications, proper membrane localization, or interaction with specific cellular components.

How can recombinant mouse Best1 protein expression be verified?

Verification of recombinant mouse Best1 expression should include both protein detection and functional assessment. For protein detection, Western blotting using specific antibodies against Best1 provides confirmation of expression and information about protein size and stability. Immunofluorescence microscopy helps determine subcellular localization, which should show membrane localization for properly functioning Best1. For functional verification, patch clamp electrophysiology remains the gold standard, measuring Ca²⁺-dependent Cl⁻ currents in expressing cells . Additionally, mRNA expression can be confirmed via RT-PCR, which is particularly useful when comparing expression levels between wild-type and mutant variants .

How do specific mutations affect Best1 protein stability and function in mouse models?

Specific mutations in mouse Best1 can affect protein stability, trafficking, and channel function in distinct ways. For example, the Y227N mutation (equivalent to human Y227N) significantly reduces protein stability in vivo, with heterozygous mice showing reduced Best1 levels in testis and homozygous mice having almost complete absence of the protein despite normal mRNA transcription . When working with recombinant Best1 carrying this mutation, researchers should anticipate potential difficulties in achieving stable expression. Other mutations may affect channel function without altering stability, requiring careful electrophysiological characterization. Functional analysis using patch clamp techniques can reveal whether mutations cause loss-of-function, gain-of-function, or dominant-negative effects on chloride channel activity .

What are the challenges in developing knock-in mouse models for Best1 mutations?

Developing knock-in mouse models for Best1 mutations presents several challenges. First, the phenotype may manifest differently between species – while human BEST1 mutations primarily affect the retina, mouse models may show more pronounced effects in other tissues like testis . Second, the penetrance and expressivity of mutations may vary depending on genetic background. When creating recombinant Best1 for in vivo studies, researchers must consider that some mutations might not produce detectable ocular phenotypes in mice despite causing macular dystrophy in humans . This necessitates comprehensive phenotyping across multiple tissues and timepoints. CRISPR/Cas9-mediated genome editing has proven effective for introducing specific mutations into the endogenous Best1 gene, allowing for the study of mutations in their native genomic context .

How can researchers distinguish between loss-of-function and gain-of-function mutations in recombinant mouse Best1?

Distinguishing between loss-of-function and gain-of-function mutations requires comprehensive functional characterization. Electrophysiological patch clamp analysis measuring Ca²⁺-dependent Cl⁻ currents at various calcium concentrations (ranging from ~0.1 to >1.0 μM [Ca²⁺]ᵢ) provides direct assessment of channel function . Loss-of-function mutations typically show reduced currents across all calcium concentrations, while gain-of-function mutations may show altered calcium sensitivity or abnormal channel kinetics. Co-expression experiments with wild-type and mutant Best1 at different ratios can reveal whether mutations act in a dominant, recessive, or dominant-negative manner . These distinctions are crucial as they dictate different therapeutic approaches – loss-of-function mutations may be amenable to gene augmentation, while gain-of-function mutations might require strategies to suppress the mutant allele .

What methodological approaches are most effective for studying allelic expression imbalance in Best1 mutations?

Allelic expression imbalance (AEI) in Best1 mutations can be studied through several complementary approaches. RNA sequencing of heterozygous samples enables quantification of wild-type versus mutant allele expression. This can be complemented by allele-specific PCR, where patient-derived cDNA is amplified, sub-cloned, and sequenced to determine the ratio of wild-type to mutant transcripts . For recombinant systems, co-transfection of tagged wild-type and mutant Best1 at controlled ratios, followed by western blotting and functional analysis, can reveal how varying allelic ratios affect protein expression and channel function. Research has shown that the ratio of mutant to wild-type Best1 can significantly impact phenotypic manifestation, with some "dominant" mutations actually behaving recessively when expressed at equal levels with wild-type protein .

What are the optimal conditions for electrophysiological characterization of recombinant mouse Best1?

Optimal electrophysiological characterization of recombinant mouse Best1 requires careful attention to several parameters. Whole-cell patch clamp recordings should be performed with pipette solutions containing precisely controlled free calcium concentrations, typically ranging from ~0.1 to >1.0 μM [Ca²⁺]ᵢ to establish the calcium dependence of channel activation . The bath solution should contain appropriate chloride concentrations to generate measurable currents. Voltage protocols typically involve step or ramp protocols ranging from -100 to +100 mV to capture the complete current-voltage relationship. Temperature control is also important, with recordings typically performed at room temperature (22-24°C). For consistent results, cell confluence and time post-transfection should be standardized (typically 24-48 hours after transfection), and expression levels should be monitored via fluorescent tags or parallel immunostaining .

How can researchers effectively model Best1-associated diseases using recombinant proteins?

Effective disease modeling with recombinant Best1 proteins requires multi-faceted approaches. For in vitro systems, researchers should consider using:

  • HEK293 cell expression systems for initial functional characterization

  • Patient-derived or genome-edited iPSC-RPE cells for more physiologically relevant studies

  • Co-expression systems with controlled ratios of wild-type and mutant Best1 to model autosomal dominant or recessive conditions

When designing experiments, include multiple mutation types (loss-of-function, gain-of-function, dominant-negative) for comparative analysis. Phenotypic assays should assess protein localization, stability (half-life measurements), channel function, and downstream cellular effects. For testing potential therapeutics, established rescue parameters and quantitative readouts are essential. The "disease-in-a-dish" model using engineered human pluripotent stem cells (hPSCs) with CRISPR/Cas9-introduced mutations offers advantages of consistent genetic background while maintaining relevant cellular context .

What strategies can be employed to rescue Best1 function in mutant proteins?

Several strategies have shown promise for rescuing Best1 function, depending on the mutation type:

  • Gene augmentation: For loss-of-function mutations, supplementation with wild-type Best1 via viral vectors (particularly AAV) has restored Ca²⁺-dependent Cl⁻ currents in patient-derived RPE cells .

  • Combined knockdown and augmentation: For gain-of-function or dominant-negative mutations, a two-step approach is needed: first silencing the endogenous mutant Best1 using CRISPR/Cas9 or gRNA-based strategies, then providing a resistant wild-type Best1 variant. This has been successfully demonstrated using BVSi 3-8-GFP for knockdown followed by expression of a wobble wild-type Best1-mCherry resistant to the gRNA .

  • Chemical chaperones: For mutations affecting protein folding or stability, chemical chaperones may help stabilize the protein and prevent degradation.

Quantitative assessment of rescue is essential, typically measuring restoration of Ca²⁺-dependent Cl⁻ currents through patch clamp electrophysiology .

What controls are essential when evaluating the effects of Best1 mutations?

When evaluating Best1 mutations, several critical controls must be included:

  • Wild-type Best1: Always include wild-type Best1 expressed under identical conditions for direct comparison.

  • Empty vector controls: Include cells transfected with expression vector lacking Best1 to account for endogenous currents.

  • Multiple calcium concentrations: Test channel function at several calcium concentrations (0.1-1.2+ μM [Ca²⁺]ᵢ) to fully characterize calcium sensitivity.

  • Expression level verification: Quantify protein expression levels via western blotting or fluorescence to ensure comparable expression between wild-type and mutant constructs.

  • Subcellular localization controls: Include markers for plasma membrane, ER, and other cellular compartments to accurately assess protein trafficking.

  • Allelic ratio controls: For co-expression experiments, verify that the intended ratios of wild-type to mutant protein are achieved.

  • Time-course measurements: Assess function and expression at multiple time points to account for differences in protein stability .

What are the most effective methods for introducing specific mutations into recombinant mouse Best1?

Site-directed mutagenesis PCR with the In-fusion Cloning Kit has proven effective for introducing specific mutations into recombinant mouse Best1 constructs . For genome editing in cellular models, CRISPR/Cas9 techniques provide efficient mutation introduction. Specifically, doxycycline-inducible Cas9 expression systems combined with specific gRNAs targeting the Best1 locus have been successfully employed . For precise mutations, including single-stranded DNA (ssDNA) templates containing the desired mutation facilitates homology-directed repair. Verification of mutations should include both DNA sequencing and confirmation of mRNA expression, ideally with allele-specific quantification. When creating stable cell lines, single-cell isolation and expansion are recommended to ensure clonal populations with the intended genetic modification .

How should researchers optimize transfection conditions for recombinant Best1 expression in different cell types?

Optimizing transfection conditions for Best1 expression requires tailored approaches for different cell types:

For HEK293 cells, lipid-based transfection using reagents like PolyJet has shown good efficiency, with 1 μg of plasmid DNA per 3.5 cm culture dish at ~50% confluency. The transfection mix should be removed after 4-8 hours, followed by rinsing with PBS .

For RPE cells, which can be more challenging to transfect, viral delivery systems often provide better results. BacMam baculovirus systems have demonstrated effective transduction of RPE cells for Best1 expression .

For iPSC or primary cell cultures, nucleofection or electroporation may offer advantages. In all cases, optimization should include:

  • Cell density testing (typically 40-70% confluency)

  • DNA:transfection reagent ratio optimization

  • Incubation time assessment

  • Serum-free vs. serum-containing media during transfection

  • Recovery time determination post-transfection

Expression should be confirmed 24-72 hours post-transfection using both protein detection methods and functional assays .

What purification approaches yield the highest quality recombinant mouse Best1 protein?

Purifying recombinant mouse Best1 presents challenges due to its multi-transmembrane domain structure. For structural and biochemical studies requiring purified protein, the following approaches have proven most effective:

  • Detergent solubilization: Using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin helps maintain protein integrity during membrane extraction.

  • Affinity purification: Adding affinity tags (His, FLAG, or twin-Strep) to either the N- or C-terminus facilitates purification. C-terminal tags are often preferred as they less frequently interfere with channel function.

  • Size exclusion chromatography: As a final purification step to isolate properly assembled pentameric Best1 channels.

For functional studies, it's often preferable to use whole cells expressing recombinant Best1 rather than purified protein, as this maintains the native membrane environment and associated proteins . When purification is necessary, verifying the functional integrity of the purified protein through reconstitution experiments is essential.

How can researchers accurately quantify Best1 protein expression and stability?

Accurate quantification of Best1 expression and stability requires multiple complementary approaches:

For protein quantification, western blotting with Best1-specific antibodies provides a direct measure of protein levels. Using fluorescently tagged Best1 variants allows for live-cell quantification and tracking. For comparing mutant and wild-type Best1 stability:

  • Pulse-chase experiments: Label newly synthesized proteins and track their degradation over time to determine half-life.

  • Cycloheximide chase assays: Block new protein synthesis and measure the rate of Best1 degradation to assess protein stability.

  • Proteasome and lysosome inhibitors: Determine the primary degradation pathway for specific Best1 variants.

mRNA quantification via qRT-PCR provides information about transcription levels, which is particularly important when investigating allelic expression imbalance . For functional assessment, patch-clamp electrophysiology measuring the magnitude of Ca²⁺-dependent Cl⁻ currents serves as a functional readout that incorporates both expression level and channel activity .

How should researchers interpret discrepancies between in vitro and in vivo findings with Best1 mutations?

When facing discrepancies between in vitro and in vivo findings with Best1 mutations, researchers should consider several explanatory factors:

  • Tissue-specific effects: While human BEST1 mutations primarily affect the retina, mouse models may show different tissue tropism, with some mutations causing phenotypes in testis but not in eyes . This suggests tissue-specific regulatory mechanisms or protein interactions.

  • Expression level differences: In vitro overexpression systems may not reflect physiological expression levels, potentially masking subtle functional defects or exaggerating mild ones.

  • Allelic expression imbalance: Some mutations showing dominant inheritance in patients may behave recessively in equal-expression in vitro systems, suggesting allelic expression imbalance in vivo .

  • Compensatory mechanisms: In vivo systems may activate compensatory pathways absent in simplified in vitro models.

  • Temporal factors: Some phenotypes may develop over extended periods not captured in acute in vitro experiments.

To address these discrepancies, researchers should employ multiple complementary models, including patient-derived cells, isogenic cell lines, and animal models at various ages, while carefully controlling for expression levels and genetic background .

What explains the variability in disease penetrance and expressivity for identical Best1 mutations?

The variability in disease penetrance and expressivity for identical Best1 mutations can be explained by several factors that researchers should consider when interpreting experimental data:

  • Allelic expression imbalance (AEI): Studies have shown that the ratio of mutant to wild-type Best1 expression can significantly impact phenotypic manifestation, with higher mutant:wild-type ratios typically resulting in more severe phenotypes .

  • Genetic modifiers: Background genetic variations may influence Best1 expression, trafficking, or function.

  • Environmental factors: Systemic factors like calcium homeostasis, inflammation, or oxidative stress may modulate the impact of Best1 mutations.

  • Epigenetic regulation: Differences in DNA methylation or histone modifications may affect allele-specific expression.

  • Age-related factors: Progressive accumulation of cellular stress or other age-related changes may influence when and how symptoms manifest.

These variables highlight the importance of studying Best1 mutations in systems that maintain genetic and environmental context, such as patient-derived cells or genome-edited isogenic lines where expression ratios can be accurately measured and controlled .

How can researchers differentiate between primary effects of Best1 mutations and secondary cellular responses?

Differentiating between primary effects of Best1 mutations and secondary cellular responses requires careful experimental design:

  • Time-course analyses: Primary effects typically manifest immediately upon mutation introduction, while secondary responses develop over time. Examining phenotypes at multiple time points can separate these effects.

  • Acute manipulation: Using inducible expression systems or acute viral delivery of wild-type or mutant Best1 helps identify immediate consequences of altered Best1 function.

  • Pathway analysis: Comprehensive transcriptomic or proteomic analysis at various time points post-mutation can reveal the temporal sequence of molecular changes.

  • Pharmacological intervention: Selectively blocking specific pathways can help determine whether observed effects are direct consequences of Best1 dysfunction or downstream adaptations.

  • Rescue experiments with specific controls: Restoring only the primary function (e.g., chloride channel activity) without affecting other potential roles of Best1 can distinguish which phenotypes are directly linked to channel dysfunction .

  • Single-cell analysis: Examination of cell-to-cell variability in responses can reveal whether effects scale directly with Best1 expression/function or follow threshold-dependent patterns typical of secondary responses.

What considerations are important when translating findings from mouse Best1 studies to human disease contexts?

When translating findings from mouse Best1 studies to human disease contexts, researchers should consider several important factors:

  • Species-specific expression patterns: While human BEST1 is predominantly expressed in RPE, mouse Best1 shows significant expression in other tissues like testis . This may lead to phenotypic differences even with equivalent mutations.

  • Structural differences: Despite high homology, subtle structural differences between mouse and human Best1 may affect how specific mutations impact protein function.

  • Physiological differences: Differences in retinal physiology, visual cycle, and RPE function between mice and humans may influence how Best1 dysfunction manifests.

  • Genetic background effects: The impact of Best1 mutations may be modulated differently by mouse versus human genetic backgrounds.

  • Temporal considerations: The relatively short lifespan of mice compared to humans may limit the development of age-related aspects of bestrophinopathies.

To address these limitations, researchers should complement mouse studies with human cell models, particularly patient-derived iPSC-RPE cells or gene-edited hPSC-RPE systems . When possible, validating key findings across multiple species and model systems provides the strongest evidence for translational relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.