Recombinant Mouse BET1-like protein (Bet1l)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Mouse BET1-like protein (Bet1l) is a laboratory-engineered form of the murine Bet1l protein, produced through heterologous expression systems such as E. coli, yeast, baculovirus, or mammalian cells . Bet1l is a vesicle-soluble NSF attachment protein receptor (SNARE) critical for retrograde transport between the endoplasmic reticulum (ER) and Golgi apparatus. It ensures Golgi integrity and facilitates vesicle docking/fusion via interactions with SNARE complexes, including GOSR1, STX5, and YKT6 .

Key Features:

  • Molecular Weight: ~12.4 kDa (human ortholog; mouse shares 91% sequence identity) .

  • Domains: Contains a SNARE motif essential for membrane fusion .

  • Localization: Primarily localizes to the Golgi but is also enriched at neuromuscular junctions (NMJs) in skeletal muscle .

Production Systems:

Expression HostPurityApplications
E. coli>90%Antibody validation, blocking assays
Yeast>85%Structural studies
Mammalian cells>95%Functional assays

Research Applications

Recombinant Bet1l is widely used to:

  • Validate Antibodies: Serves as a positive control in Western blot (WB) and immunohistochemistry (IHC) .

  • Study Neuromuscular Diseases: Used in siRNA knockdown models to investigate Bet1l’s role in amyotrophic lateral sclerosis (ALS). Bet1l deficiency accelerates NMJ denervation and motor neuron degeneration in SOD1 G93A transgenic rats .

  • Blocking Experiments: Pre-incubated with antibodies (e.g., PA5-58943) to confirm specificity in IHC and WB .

Role in ALS Pathogenesis:

  • NMJ Integrity: Bet1l localizes to NMJ basal lamina. Its downregulation precedes symptom onset in ALS models, correlating with NMJ degeneration .

  • Disease Progression: Muscle-specific Bet1l knockdown in rats increases denervated NMJs by 40%, reduces motor neuron size by 25%, and worsens motor function .

  • Therapeutic Target: Bet1l loss disrupts retrograde signaling from muscle to neurons, suggesting its potential as a biomarker or therapeutic target for ALS .

Table: Bet1l Expression in ALS Models

ModelBet1l ExpressionFunctional Impact
SOD1 G93A transgenic rat↓ 50% (presymptomatic)NMJ denervation, motor dysfunction
Human iPSC-derived myocytes (ALS)↓ 60–70%Impaired vesicle trafficking

Technical Validation

  • Western Blot: Anti-Bet1l antibodies (e.g., A10822) detect recombinant Bet1l at 12–15 kDa in lysates from HEK293T and HeLa cells .

  • Specificity Confirmation: Antigen-blocking assays using recombinant Bet1l eliminate NMJ staining in muscle sections .

  • Interactome Analysis: STRING database identifies Bet1l partners like Gosr1 (score: 0.999) and Stx5a (score: 0.999), underscoring its role in Golgi-ER trafficking .

Future Directions

  • Mechanistic Studies: Elucidate Bet1l’s role in NMJ maintenance and retrograde signaling pathways.

  • Clinical Translation: Evaluate Bet1l levels in ALS patient biofluids as a prognostic biomarker .

  • Therapeutic Development: Explore gene therapy or small molecules to restore Bet1l expression in ALS models.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific requirement for the format, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributor for specific delivery times.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Bet1l; Gs15; BET1-like protein; Golgi SNARE with a size of 15 kDa; GOS-15; GS15; Vesicle transport protein GOS15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Bet1l
Target Protein Sequence
MADWTRAQSSGAVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMARSGRDNRKLLCGMAVVLIVAFFILSYLLSRTRT
Uniprot No.

Target Background

Function
Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. It is essential for maintaining the integrity of the Golgi complex.
Gene References Into Functions
  1. Two amino acid substitutions do not regulate secretion by affecting the property of SNARE complex itself. PMID: 16195346
Database Links
Subcellular Location
Golgi apparatus membrane; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane.

Q&A

What is Bet1l and what are its primary cellular functions?

Bet1l is a Golgi vesicular membrane trafficking protein that appears to play important roles in cellular transport mechanisms. Research indicates that Bet1l localizes to the basal lamina of the neuromuscular junction (NMJ), suggesting involvement in the specialized structural organization of this synaptic connection . Functionally, Bet1l likely participates in vesicular transport pathways, potentially mediating protein delivery to the NMJ that maintains synaptic integrity and function. Methodologically, researchers investigating Bet1l function typically employ immunohistochemistry with specific antibodies to visualize its subcellular localization, combined with genetic manipulation to assess functional consequences of altered expression.

How is Bet1l expression typically measured in mouse tissue samples?

Bet1l expression in mouse tissues is commonly assessed using quantitative reverse-transcription polymerase chain reaction (RT-qPCR) for mRNA levels and immunohistochemistry for protein localization and abundance . When designing primers for RT-qPCR, researchers should target conserved regions of the transcript to ensure specific amplification. For protein detection, immunohistochemistry protocols typically involve tissue fixation, sectioning, antigen retrieval, and labeling with Bet1l-specific antibodies, followed by appropriate secondary antibodies for visualization. Validation of antibody specificity through knockout controls is essential for reliable results.

What are the typical expression patterns of Bet1l in different mouse tissues?

While comprehensive tissue expression profiles for mouse Bet1l are still being established, research has demonstrated significant expression in skeletal muscle, particularly at the neuromuscular junction . Researchers interested in characterizing Bet1l expression across tissues should consider employing both transcriptomic approaches (RNA-seq or microarray analysis) and protein-level detection methods (Western blotting of tissue lysates and immunohistochemistry). Special attention should be paid to neuromuscular junctions, which can be visualized using α-bungarotoxin (BTX) staining followed by co-staining with Bet1l antibodies.

How is Bet1l implicated in amyotrophic lateral sclerosis (ALS) pathophysiology?

Transcriptome analysis of patient-derived iPSC skeletal myocytes has identified Bet1l as one of four genes consistently downregulated in ALS patients compared to healthy controls . Critically, this finding was validated in an independent animal model, with Bet1l being the only gene also downregulated in hind limb muscle samples from SOD1 G93A transgenic rats .

Immunohistochemical analyses revealed that Bet1l protein localizes to the NMJ basal lamina, and its expression decreases during disease progression in SOD1 G93A rats, correlating with NMJ degeneration . This suggests a potential role in the early pathophysiological processes of ALS. Importantly, Bet1l downregulation was observed across diverse genetic backgrounds of ALS (including C9ORF72, SOD1, and TARDBP mutations) and in sporadic ALS, pointing to a common pathological mechanism.

Researchers investigating this association should consider:

  • Temporal tracking of Bet1l expression throughout disease progression

  • Functional studies addressing whether Bet1l loss is causative or consequential in NMJ degeneration

  • Rescue experiments to determine if restoring Bet1l expression can preserve NMJ integrity

What is the association between Bet1l genetic variants and uterine fibroid risk?

Genome-wide association studies have identified significant associations between Bet1l genetic variants and uterine fibroid risk. Specifically, the single nucleotide polymorphism (SNP) rs2280543 in the BET1L gene shows strong association with uterine fibroid risk across multiple populations . A meta-analysis combining data from European American cohorts (RFTS and BioVU) with a Japanese GWAS demonstrated a consistent protective effect of this variant (meta-OR = 0.66, p = 3.89×10^-9) .

The table below summarizes key statistical findings from the meta-analysis:

Meta-Analysis PopulationsGeneMinor Allelers #Odds RatioStandard ErrorQIP-value
RFTS EA and BioVUBET1LTrs22805430.670.150.7006.9×10^-3
RFTS EA, BIOVU EA, and Prior Japanese GWASBET1LTrs22805430.660.070.9203.89×10^-9

Researchers investigating this association should consider:

  • Functional studies to determine how rs2280543 affects Bet1l expression or function

  • Investigation of potential mechanisms linking Bet1l to fibroid development

  • Analysis of Bet1l expression in uterine tissue and fibroids

How do researchers quantify Bet1l protein presence at neuromuscular junctions in disease models?

To quantify Bet1l at NMJs in disease models, researchers typically use immunohistochemistry with Bet1l-specific antibodies combined with α-bungarotoxin (BTX) to label acetylcholine receptors at the NMJ . The methodological approach involves:

  • Muscle section preparation and labeling with BTX and Bet1l antibodies

  • Scanning sections using fluorescence microscopy (e.g., Nikon Eclipse 80i)

  • Counting NMJs positive or negative for Bet1l in a blinded fashion

  • Analyzing a sufficient number of NMJs per animal (~80-100) with multiple animals per group (4+ per condition)

  • Comparing across different disease stages (presymptomatic, symptomatic, end-point)

This approach allowed researchers to establish that the percentage of Bet1l-positive NMJs decreases during ALS progression in SOD1 G93A rats, correlating with disease advancement .

What are the optimal storage conditions for recombinant mouse Bet1l protein?

Based on standard practices for recombinant proteins similar to Bet1l, researchers should store lyophilized recombinant Bet1l protein at -20°C to -80°C for long-term storage. After reconstitution in sterile PBS (typically at 100 μg/mL), the protein should be aliquoted to avoid repeated freeze-thaw cycles and stored at -80°C . When designing experiments, researchers should include positive controls to verify protein activity after storage and reconstitution. Stability testing at regular intervals using functional assays or structural analysis techniques can help establish optimal storage duration.

What are the recommended methodologies for validating the purity and activity of recombinant Bet1l?

Validating recombinant Bet1l requires multiple analytical approaches:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (expected single band at the predicted molecular weight)

    • Western blotting with Bet1l-specific antibodies

    • Mass spectrometry for accurate mass determination and peptide mapping

  • Functional validation:

    • Binding assays with known interaction partners

    • Vesicular trafficking assays in cellular systems

    • Cell-based activity assays relevant to Bet1l's proposed functions

  • Structural integrity:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to confirm proper protein folding

For research requiring high confidence in protein quality, combining multiple validation methods is recommended.

What are the key considerations when designing experiments to investigate Bet1l's role in ALS pathophysiology?

When investigating Bet1l's role in ALS, researchers should consider:

  • Model systems:

    • Patient-derived iPSC skeletal myocytes (representing both familial and sporadic ALS)

    • SOD1 G93A transgenic rat models that recapitulate ALS progression

    • Bet1l knockout or knockdown models to assess direct causality

  • Temporal considerations:

    • Sample collection at multiple disease stages (presymptomatic, early symptomatic, late-stage)

    • Longitudinal studies to track Bet1l changes in individual subjects over time

  • Analytical approaches:

    • Transcriptomic analysis (RNA-seq, microarrays, RT-qPCR)

    • Protein quantification (Western blotting, immunohistochemistry)

    • Functional assays of NMJ integrity and function

    • Co-localization studies with NMJ markers and components of the basal lamina

  • Controls:

    • Age-matched controls for all disease stages

    • Multiple patient lines representing different genetic forms of ALS

    • Blinded analysis to prevent observer bias

How should researchers approach studying the potential interaction between Bet1l and collagen IV at the neuromuscular junction?

Based on observations that Bet1l protein appears to be part of the basal lamina and shows overlap with collagen IV staining , researchers investigating this interaction should:

  • Employ high-resolution imaging techniques:

    • Super-resolution microscopy (STED, STORM, PALM)

    • Confocal microscopy with deconvolution

    • Electron microscopy with immunogold labeling

  • Utilize biochemical interaction studies:

    • Co-immunoprecipitation of Bet1l and collagen IV

    • Proximity ligation assays in tissue sections

    • FRET or BRET assays in cellular models

  • Apply genetic approaches:

    • Conditional knockout of Bet1l specifically at the NMJ

    • Domain mapping to identify interaction regions

    • Site-directed mutagenesis of potential binding sites

  • Include appropriate controls:

    • Other basal lamina proteins for specificity

    • Spatial controls (non-NMJ regions)

    • Negative controls lacking primary antibodies

How should researchers interpret contradictory findings regarding Bet1l expression across different disease models?

When facing contradictory findings regarding Bet1l expression across models:

  • Consider model-specific factors:

    • Different genetic backgrounds (e.g., various ALS mutations vs. sporadic ALS)

    • Species differences (human iPSC-derived cells vs. rat models)

    • Disease stage (early vs. late changes)

    • Cell type specificity (motor neurons vs. muscle cells)

  • Apply integrative analysis approaches:

    • Meta-analysis of multiple datasets with attention to heterogeneity metrics (Q and I statistics)

    • Pathway analysis to identify common downstream effectors

    • Systems biology approaches to place contradictory findings in biological context

  • Validate findings through orthogonal methods:

    • If mRNA changes don't match protein changes, investigate post-transcriptional regulation

    • Confirm antibody specificity if protein detection is inconsistent

    • Perform functional studies to determine biological relevance of observed changes

What statistical approaches are recommended for analyzing Bet1l genetic association data in disease studies?

For genetic association studies involving Bet1l:

  • Primary analysis methods:

    • Logistic regression assuming an additive genotypic model (0, 1, 2 minor alleles)

    • Calculation of odds ratios with confidence intervals

    • Adjustment for potential confounders (age, BMI, ethnicity)

    • Testing for Hardy-Weinberg Equilibrium to ensure quality genotyping

  • Meta-analysis approaches:

    • Fixed-effects models for combining data across cohorts

    • Assessment of heterogeneity using Q statistics and I² index

    • Forest plots to visualize effect sizes across studies

  • Multiple testing considerations:

    • Bonferroni correction for genome-wide significance (p < 5×10^-8)

    • False Discovery Rate (FDR) approaches

    • Replication in independent cohorts to confirm associations

As demonstrated in the BET1L rs2280543 association with uterine fibroids, meta-analysis across multiple populations strengthened the evidence of association (p = 3.89×10^-9), exceeding the canonical genome-wide significance threshold .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.