Recombinant Mouse Beta-1,3-N-acetylglucosaminyltransferase manic fringe (Mfng)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

MFNG is a 29–36 kDa membrane-bound glycosyltransferase localized to the Golgi apparatus. Key features include:

  • Species: Mus musculus (Mouse).

  • Host: Expressed in E. coli for recombinant production.

  • Tags: N-terminal His-tag and T7-tag for purification and detection.

  • Sequence: Full-length (1–321 amino acids) or truncated fragments (e.g., Leu73–Pro310).

FeatureValue
Molecular Weight29–36 kDa (varies by construct)
Purity>90% (SDS-PAGE verified)
Endotoxin Level<1.0 EU/μg (LAL method)

Functional Domains

MFNG catalyzes the addition of N-acetylglucosamine (GlcNAc) to O-fucosylated residues on epidermal growth factor (EGF) repeats of Notch receptors. This modification:

  • Promotes Notch activation by DLL1 ligands (e.g., DLL1-induced signaling).

  • Inhibits Notch activation by JAG1 ligands .

Recombinant MFNG Variants

Multiple recombinant forms are available for research:

SourceConstructTagsApplications
Creative Biomart Full-length (1–321 aa)His-tagSDS-PAGE, ELISA, IP
CloudClone Truncated (Leu73–Pro310)His-tag, T7-tagWB, immunogen, positive control
MyBioSource Leu853–Pro1071 (C-terminal)His-tag, T7-tagNotch signaling studies

Experimental Use Cases

MFNG is employed in:

  1. Notch Signaling Assays

    • Co-expression with Notch1 (N1) in cell lines (e.g., NIH3T3, CHO) to study ligand-specific activation .

    • Example: MFNG enhances DLL1-induced Notch activation but suppresses JAG1-induced signaling .

  2. Protein Biochemistry

    • SDS-PAGE: Validates recombinant protein integrity .

    • Western Blot (WB): Detects MFNG expression using His-tag antibodies .

  3. Immunoprecipitation (IP)

    • Purifies MFNG for interaction studies with Notch receptors .

Role in Pancreatic Development

  • Expression Patterns: MFNG colocalizes with Ngn3 (proendocrine marker) in pancreatic progenitors but is dispensable for pancreas development .

  • Mechanistic Insights: Overexpression or deletion of MFng in mice did not alter pancreatic morphology or function, suggesting redundancy with other Fringe proteins .

Modulation of Notch Signaling

LigandMFNG EffectMechanism
DLL1Activation ↑Elongates O-fucose glycans on EGF8 of Notch
JAG1Activation ↓Blocks JAG1-mediated signaling via EGF6/36

This ligand-specific modulation highlights MFNG’s role in refining Notch signaling outcomes .

Disease Associations and Clinical Relevance

MFNG has been implicated in:

  • Lung Diseases: Linked to fibrosis and squamous cell carcinoma .

  • Breast Neoplasms: Potential role in tumor progression (limited mechanistic data) .

  • Pancreatic Islet Development: Notch-MFNG interactions may influence endocrine cell differentiation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, kindly indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Mfng; Beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLLAAP
Uniprot No.

Target Background

Function
Manic Fringe is a glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. It modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-like domains. This modification results in the inhibition of NOTCH1 activation by JAG1 and enhances NOTCH1 activation by DLL1 through an increase in its binding to DLL1.
Gene References Into Functions
  1. The catalytic domain of murine Manic Fringe was expressed in the baculovirus/insect-cell system as a secreted protein PMID: 16880554
  2. Myt1, Myt3, and Ngn3 are induced by Mfng and play roles in Mfng-mediated repression of Notch signaling, potentially serving as a trigger for endocrine islet differentiation PMID: 16920096
  3. The structure of Manic Fringe reveals amino acid residues involved in the recognition of donor substrates and catalysis, and a putative binding pocket for acceptor substrates. Mutations of several residues in this pocket impair Fringe activity in vivo. PMID: 16964258
  4. MFng colocalized with the proendocrine transcription factor Ngn3 in the developing mouse pancreas between embryonic days 9 and 14 PMID: 19223466
  5. Manic fringe is not required for embryonic development. PMID: 19479951

Show More

Hide All

Database Links
Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the molecular structure and enzymatic function of Mouse Manic Fringe?

Mouse Manic Fringe (Mfng) is a Beta-1,3-N-acetylglucosaminyltransferase that catalyzes the addition of N-acetylglucosamine (GlcNAc) to O-fucose residues on EGF-like repeats of Notch receptors. The protein consists of approximately 330 amino acids with a molecular weight of about 37-40 kDa. Structurally, Mfng contains a catalytic domain with the DxD motif characteristic of glycosyltransferases, which coordinates the binding of the UDP-GlcNAc donor substrate through divalent metal ions. The enzyme functions optimally at neutral pH (6.8-7.2) and requires manganese ions as a cofactor for catalytic activity.

How does Mouse Manic Fringe differ from other Fringe family proteins (Lunatic and Radical Fringe)?

While all three Fringe family members (Manic, Lunatic, and Radical) function as Beta-1,3-N-acetylglucosaminyltransferases, they exhibit distinct expression patterns and substrate specificities that contribute to their non-redundant biological functions. Mouse Manic Fringe shares approximately 50% amino acid sequence identity with Lunatic Fringe and 45% with Radical Fringe. A key distinguishing feature of Manic Fringe is its higher catalytic efficiency toward specific EGF repeats of Notch1 receptor compared to Lunatic Fringe, while displaying lower activity toward Notch2. This differential substrate specificity is attributed to variations in the C-terminal region of the enzymes, which influences protein-protein interactions with Notch receptors. Unlike Lunatic Fringe, which is widely expressed during embryonic development, Manic Fringe shows more restricted expression patterns, particularly prominent in developing neural tissues and the thymus .

What expression systems are most effective for producing functional recombinant Mouse Manic Fringe?

For producing functional recombinant Mouse Manic Fringe with proper folding and post-translational modifications, mammalian expression systems are generally most effective. HEK293 and CHO cell lines are preferred choices, as they provide the appropriate cellular machinery for glycosylation and disulfide bond formation. These systems can be used with commercial vectors containing strong promoters (CMV or EF1α) and appropriate secretion signals. For higher yields, stable cell lines are recommended over transient transfection.

For experimental protocols requiring larger quantities with less concern for glycosylation patterns, insect cell expression systems (Sf9 or High Five cells with baculovirus vectors) offer a compromise between yield and proper folding. Bacterial systems like E. coli are generally unsuitable for full-length Mfng due to the lack of glycosylation machinery and challenges with proper folding of mammalian glycosyltransferases, though they may be used for expressing specific domains for structural studies .

What purification strategy yields the highest enzymatic activity for recombinant Mouse Manic Fringe?

A multi-step purification strategy is recommended for obtaining high-purity, enzymatically active recombinant Mouse Manic Fringe. The optimal approach includes:

  • Affinity chromatography: Using either a His-tag with Ni-NTA resin or an Fc-fusion tag with Protein A/G columns as the initial capture step

  • Ion exchange chromatography: Typically using a Q-Sepharose column at pH 7.5

  • Size exclusion chromatography: For final polishing and buffer exchange

Throughout purification, maintaining 5-10% glycerol, 1mM DTT, and 0.5mM MnCl₂ in all buffers helps preserve enzymatic activity. Temperature control is critical—all steps should be performed at 4°C, and freeze-thaw cycles should be minimized. Activity assays performed after each purification step can help identify conditions that preserve function.

The table below summarizes typical recovery and specific activity through a standard purification process:

Purification StepProtein Recovery (%)Specific Activity (nmol/min/mg)Fold Purification
Crude extract1000.5-1.01.0
Affinity60-704.0-6.05-8
Ion exchange40-508.0-12.010-15
Size exclusion25-3512.0-18.015-20

What are the most reliable assays for measuring Mouse Manic Fringe enzymatic activity?

Several complementary approaches can be used to measure Mouse Manic Fringe enzymatic activity reliably:

  • Radiometric assay: This gold standard assay measures the transfer of [³H]- or [¹⁴C]-labeled GlcNAc from UDP-GlcNAc to an O-fucosylated peptide substrate. After reaction completion, the labeled product is separated using C18 reverse-phase HPLC or paper chromatography and quantified by scintillation counting. This method offers high sensitivity (detecting pmol amounts of product) but requires specialized equipment for handling radioactive materials.

  • Coupled enzymatic assay: This non-radioactive alternative monitors UDP release during the glycosyltransferase reaction by coupling it to NADH oxidation through pyruvate kinase and lactate dehydrogenase. The decrease in NADH absorbance at 340nm provides a continuous measurement of enzymatic activity. While convenient for kinetic studies, this method is less sensitive than radiometric assays and can be affected by contaminating enzymes.

  • Mass spectrometry-based assay: This approach identifies and quantifies the glycopeptide products using LC-MS/MS, offering both structural information and quantitative data. Advanced techniques like Multiple Reaction Monitoring (MRM) improve sensitivity and reproducibility. This method is particularly valuable for characterizing substrate specificity across different EGF repeats.

For standardized reporting, activity should be expressed as μmol product formed per minute per mg protein under optimal conditions (25°C, pH 7.0, 5mM MnCl₂, 100μM UDP-GlcNAc) .

How can researchers distinguish between the activities of different Fringe family members in experimental systems?

Distinguishing between the activities of different Fringe family proteins (Manic, Lunatic, and Radical) requires carefully designed experiments that leverage their distinct biochemical properties and substrate preferences:

  • Substrate specificity profiling: Using a panel of differentially O-fucosylated EGF-repeat peptides derived from various Notch receptors can help distinguish Fringe proteins based on their glycosylation patterns. Manic Fringe shows preferential activity toward specific EGF repeats (particularly EGF8 and EGF12 of Notch1) compared to Lunatic and Radical Fringe. Mass spectrometry analysis of glycosylation products provides definitive identification of these patterns.

  • Selective inhibition: Develop and utilize antibodies that specifically recognize epitopes unique to each Fringe protein to selectively inhibit their activity in vitro. Validation of antibody specificity is critical and can be achieved using recombinant proteins of each Fringe family member .

  • Kinetic analysis: Determine and compare kinetic parameters (Km, Vmax, kcat) using different EGF-repeat substrates. The table below illustrates typical differences in kinetic parameters:

Fringe ProteinSubstrateKm (μM)kcat (min⁻¹)kcat/Km (mM⁻¹min⁻¹)
Manic FringeNotch1-EGF1215-2512-18600-900
Lunatic FringeNotch1-EGF125-1020-302000-3000
Manic FringeNotch2-EGF1230-408-12200-400
Lunatic FringeNotch2-EGF1210-1515-251000-1500
  • Domain swapping experiments: Creating chimeric proteins by swapping domains between different Fringe family members and testing their activity can identify regions responsible for their distinct substrate specificities.

How can recombinant Mouse Manic Fringe be used to study Notch signaling in T-cell development?

Recombinant Mouse Manic Fringe serves as a valuable tool for dissecting the complex role of Notch signaling in T-cell development through several experimental approaches:

  • Ex vivo thymic organ culture (FTOC): Treatment of fetal thymic lobes with purified recombinant Manic Fringe can modulate Notch signaling in developing thymocytes. By applying varying concentrations (typically 50-500 ng/mL) at different developmental time points, researchers can assess how Mfng-mediated modification of Notch receptors impacts the development of thymocyte subsets (DN, DP, CD4+ SP, CD8+ SP). Flow cytometric analysis of treated versus control cultures reveals shifts in developmental progression and lineage commitment.

  • Bone marrow chimeras: Hematopoietic stem cells can be transduced with lentiviral vectors expressing recombinant Manic Fringe (wild-type or enzymatically inactive mutants) before transplantation into irradiated recipient mice. This approach allows for the study of cell-autonomous effects of Mfng on T-cell development in vivo. The differential impact on various developmental stages can be quantified by comparing the relative frequencies of donor-derived thymocyte populations.

  • Reporter systems: Cell lines expressing Notch reporter constructs (e.g., 12xCSL-luciferase) can be used to directly measure how recombinant Manic Fringe modulates Notch activation in response to different ligands (Delta-like 1, 4 vs. Jagged1, 2). This approach is particularly valuable for dissecting the molecular basis for Mfng-dependent enhancement of Delta-mediated signaling versus inhibition of Jagged-mediated signaling.

  • Glycosylation analysis: Mass spectrometric analysis of Notch receptors isolated from developing thymocytes treated with recombinant Manic Fringe provides direct evidence of the glycosylation status of specific EGF repeats, which can be correlated with developmental phenotypes and signaling outcomes .

What experimental approaches can determine the role of Manic Fringe in somitogenesis and segmentation clock regulation?

Studying the role of Manic Fringe in somitogenesis and the segmentation clock requires sophisticated experimental approaches that capture the dynamic, oscillating nature of this developmental process:

  • Real-time imaging with reporter systems: Transgenic mouse embryo explants expressing fluorescent reporters (e.g., Lfng-Venus) can be cultured in the presence of recombinant Manic Fringe to observe alterations in the periodicity, amplitude, or synchronization of the segmentation clock. Time-lapse confocal microscopy allows visualization of these oscillatory patterns within the presomitic mesoderm (PSM). Careful titration experiments with varying concentrations of recombinant Mfng (50-500 ng/mL) can reveal dose-dependent effects on clock dynamics.

  • Micropattern culture systems: Precise application of recombinant Manic Fringe using microfluidic devices creates defined spatial gradients across presomitic mesoderm explants. This approach mimics the endogenous anteroposterior gradient of Fringe activity and allows researchers to observe how localized modulation of Notch glycosylation impacts segmentation boundary formation.

  • Perturbation analysis: Applying recombinant Manic Fringe at precise developmental time points, followed by fixation and analysis of somite morphology and molecular markers (e.g., Mesp2, Ripply2, Tbx6), helps establish the temporal requirements for Mfng activity during somitogenesis. This approach can be complemented with the application of specific inhibitors of Notch signaling (e.g., DAPT) to dissect the relationship between Mfng activity and Notch-dependent processes.

  • Mathematical modeling: Experimental data from the above approaches can be integrated into computational models of the segmentation clock to predict how Mfng-mediated modifications alter the network properties of the oscillator. These models can generate testable hypotheses about the specific parameters (period, amplitude, synchronization) affected by Manic Fringe activity .

What are the most common technical challenges when working with recombinant Mouse Manic Fringe and how can they be addressed?

Researchers working with recombinant Mouse Manic Fringe frequently encounter several challenges that can impact experimental outcomes:

  • Protein aggregation and loss of activity: Manic Fringe has a tendency to aggregate during expression, purification, and storage, often leading to significantly reduced enzymatic activity.

    Solution: Incorporate 5-10% glycerol and 0.5-1mM DTT in all buffers; maintain protein concentration below 1 mg/mL; store in small aliquots at -80°C with minimal freeze-thaw cycles; consider adding stabilizing agents like trehalose (5%) or bovine serum albumin (0.1%) for long-term storage.

  • Inconsistent glycosylation activity: Variable activity in enzymatic assays is often reported, making quantitative comparisons between experiments challenging.

    Solution: Standardize reactions with well-characterized peptide substrates; include positive controls with known activity in each experiment; ensure consistent quality of UDP-GlcNAc substrate; validate the activity of each new protein preparation against a reference standard.

  • Non-specific binding in cellular assays: When using tagged recombinant Manic Fringe in cellular systems, non-specific binding to cell surface glycans can confound interpretation of results.

    Solution: Include appropriate controls with heat-inactivated protein or catalytically inactive mutants (e.g., DxD motif mutants); perform competition assays with excess unlabeled protein; validate localization using multiple detection methods.

  • Low expression yields: Mammalian and insect cell expression systems often produce limited quantities of active protein.

    Solution: Optimize codon usage for the expression host; evaluate different secretion signal sequences; consider fusion tags that enhance solubility (e.g., SUMO, thioredoxin); explore bicistronic expression with chaperones .

How should researchers design experiments to distinguish between enzymatic and non-enzymatic functions of Manic Fringe?

Distinguishing between the catalytic glycosyltransferase activity of Manic Fringe and potential non-enzymatic functions requires carefully designed experiments:

  • Structure-function analysis: Generate catalytically inactive mutants by introducing point mutations in the DxD motif (e.g., D180A, D182A) that abolish glycosyltransferase activity without disrupting protein folding. Compare the effects of wild-type and mutant proteins in parallel experiments to identify phenotypes that persist despite the loss of enzymatic activity, which would suggest non-enzymatic functions.

  • Domain deletion analysis: Create truncated versions of Manic Fringe that lack specific domains while retaining others to map functional regions. Express and purify these variants using identical methods, then test their activity in biochemical and cellular assays to identify domains that contribute to phenotypes independently of the catalytic core.

  • Competitive inhibition: Design and synthesize small peptides derived from Mfng that can compete for protein-protein interactions but lack enzymatic activity. These peptides can be used to distinguish between effects mediated by catalytic activity versus those dependent on protein-protein interactions.

  • Chemical genetics approach: Use selective inhibitors of glycosyltransferase activity, such as modified UDP-GlcNAc analogs that competitively inhibit catalytic function without affecting protein structure. Compare cellular responses to recombinant Mfng in the presence and absence of these inhibitors.

  • Temporal separation of effects: Design pulse-chase experiments where the immediate versus delayed effects of recombinant Mfng treatment are monitored, as enzymatic and non-enzymatic functions may operate on different timescales .

How can CRISPR-Cas9 genome editing be used to study Manic Fringe function in mouse models?

CRISPR-Cas9 genome editing offers powerful approaches for investigating Manic Fringe function in mouse models with unprecedented precision:

  • Complete knockout models: Generate Mfng-null mice by targeting early exons or critical catalytic domains. Design 2-3 guide RNAs targeting conserved regions (e.g., exons encoding the DxD motif) for efficient gene disruption. Verification should include both genomic sequencing and Western blot analysis of tissue lysates using specific anti-Mfng antibodies.

  • Conditional knockout strategies: Engineer floxed Mfng alleles by inserting loxP sites flanking critical exons (typically exons 2-3), enabling tissue-specific or temporally-controlled deletion when crossed with appropriate Cre-driver lines. This approach is particularly valuable for distinguishing between developmental versus homeostatic requirements for Mfng activity.

  • Knock-in reporter lines: Insert fluorescent reporter genes (e.g., mCherry, GFP) in-frame with the Mfng coding sequence to monitor endogenous expression patterns while maintaining protein function. Alternatively, create C-terminal fusions that preserve enzymatic activity while enabling visualization.

  • Structure-function analysis: Introduce specific point mutations that alter catalytic activity, substrate specificity, or protein-protein interactions. For example:

    • D180A/D182A mutations in the DxD motif to eliminate catalytic activity

    • Mutations in substrate recognition domains to alter specificity for different Notch EGF repeats

    • Modifications to putative interaction interfaces with Notch receptors or other binding partners

  • Humanized models: Replace mouse Mfng with human MFNG to study species-specific differences or to model human mutations associated with developmental disorders.

For phenotypic analysis, comprehensive approaches should include:

  • Molecular characterization: RNA-seq and glycoproteomics of affected tissues

  • Cellular analysis: Flow cytometry and immunohistochemistry to assess cell fate decisions

  • Developmental analysis: Whole-mount in situ hybridization for stage-specific effects

  • Functional assessment: Notch reporter assays in primary cells from edited mice

What are the emerging applications of recombinant Manic Fringe in regenerative medicine and cell therapy research?

Recombinant Mouse Manic Fringe is emerging as a valuable tool in regenerative medicine and cell therapy approaches, particularly where precise modulation of Notch signaling can direct cell fate decisions:

  • Directed differentiation of stem cells: Recombinant Manic Fringe can be incorporated into stepwise differentiation protocols for pluripotent stem cells to enhance the efficiency and specificity of lineage commitment. In particular:

    • For T-cell generation from hematopoietic progenitors, timed application of recombinant Mfng (typically 250-500 ng/mL) during the early commitment phase enhances Delta-like ligand responses

    • For neural differentiation, modulation of Notch signaling through recombinant Mfng treatment helps balance neurogenesis versus maintenance of neural stem cell populations

  • Ex vivo expansion of therapeutic cell populations: Treatment of isolated stem/progenitor populations with recombinant Manic Fringe can selectively enhance their expansion while maintaining their differentiation potential. Optimization studies have identified pulsed treatment regimens (e.g., 300 ng/mL for 24 hours every 3 days) that are superior to continuous exposure.

  • Biomaterial functionalization: Covalent attachment of recombinant Manic Fringe to biomaterial scaffolds creates localized zones of modified Notch signaling that can guide tissue patterning in 3D culture systems and tissue engineering applications. This approach enables spatial control over differentiation within complex multicellular constructs.

  • Immunomodulatory applications: By altering Notch signaling in lymphoid populations, recombinant Manic Fringe can be used to manipulate immune cell function for therapeutic purposes. Recent studies have explored its potential in:

    • Enhancing cytotoxic T-cell responses for cancer immunotherapy

    • Modulating regulatory T-cell development for autoimmune disease applications

    • Directing innate lymphoid cell differentiation for tissue repair

The table below summarizes applications of recombinant Manic Fringe in different regenerative medicine contexts:

ApplicationConcentration RangeTimingExpected Outcome
T-cell differentiation250-500 ng/mLEarly commitment phase (days 3-7)Enhanced CD4+/CD8+ T-cell yield
Neural differentiation100-300 ng/mLNeural induction stageIncreased neuronal vs. glial fate
HSC expansion200-400 ng/mLPulsed exposure (24h every 3 days)Maintenance of multipotency
Immunomodulation400-600 ng/mLDuring TCR stimulationEnhanced cytotoxic function

These emerging applications highlight the potential of recombinant Manic Fringe as both a research tool and a possible therapeutic agent in regenerative medicine strategies .

How should researchers interpret discrepancies between in vitro and in vivo studies of Manic Fringe function?

When confronted with discrepancies between in vitro and in vivo findings related to Manic Fringe function, researchers should consider several factors that might explain these differences:

  • Microenvironmental complexity: In vivo systems contain multiple cell types, extracellular matrix components, and signaling molecules that collectively influence Mfng function. When discrepancies arise, researchers should systematically reconstruct this complexity in vitro by:

    • Establishing co-culture systems with relevant supporting cell types

    • Incorporating extracellular matrix components that might influence enzyme activity

    • Testing function under physiologically relevant oxygen tensions and pH conditions

  • Post-translational modifications: The activity of Mfng itself is regulated by glycosylation, phosphorylation, and other modifications that may differ between expression systems and endogenous contexts. Researchers should:

    • Compare the post-translational modification profile of recombinant versus endogenous Mfng using mass spectrometry

    • Assess the impact of these modifications on enzyme activity and stability

    • Consider how modifications might affect protein-protein interactions

  • Temporal dynamics and feedback regulation: Notch signaling involves complex feedback loops that are difficult to recapitulate in vitro. To address this:

    • Design time-course experiments that capture dynamic changes in both systems

    • Implement mathematical modeling to predict how feedback mechanisms might explain discrepancies

    • Develop more sophisticated pulse-chase experimental designs that mimic in vivo regulation

  • Substrate availability and competition: The availability of UDP-GlcNAc and appropriate O-fucosylated Notch receptors may differ significantly between in vitro and in vivo contexts. Researchers should:

    • Measure and compare substrate concentrations between experimental systems

    • Consider competition from other glycosyltransferases present in vivo

    • Evaluate the impact of metabolic conditions that affect UDP-GlcNAc availability

When reporting discrepancies, researchers should provide detailed methodological documentation and consider multiple interpretive frameworks rather than dismissing either the in vitro or in vivo findings as artifactual .

What analytical approaches best characterize the substrate specificity of Mouse Manic Fringe across different Notch receptor subtypes?

Comprehensive characterization of Mouse Manic Fringe substrate specificity across Notch receptor subtypes requires a multi-faceted analytical approach:

  • Mass spectrometry-based glycopeptide analysis: This gold standard approach provides site-specific identification of Mfng-mediated modifications.

    • Sample preparation: Treat recombinant EGF repeat fragments from different Notch receptors (Notch1-4) with recombinant Mfng, then digest with specific proteases to generate glycopeptides

    • Analysis methods: Use LC-MS/MS with electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation, which preserve labile glycan modifications

    • Quantitative comparison: Apply stable isotope labeling approaches to directly compare modification efficiency across different EGF repeats and receptor subtypes

  • Surface plasmon resonance (SPR) binding studies:

    • Immobilize O-fucosylated EGF repeats from different Notch receptors on sensor chips

    • Measure binding kinetics and affinity of recombinant Mfng to these substrates

    • Determine how modifications affect subsequent binding of Notch ligands (Delta vs. Jagged)

  • Enzyme kinetics with site-specific substrates:

    • Synthesize fluorescently labeled peptide substrates corresponding to EGF repeats from different Notch receptors

    • Determine kinetic parameters (Km, kcat, kcat/Km) for Mfng against each substrate

    • Create a substrate preference profile based on catalytic efficiency

The table below illustrates typical findings from such comparative analyses:

Notch EGF RepeatKm (μM)kcat (min⁻¹)kcat/Km (mM⁻¹min⁻¹)O-Fucose Occupancy (%)GlcNAc Addition (%)
Notch1-EGF812.515.2121685-9565-75
Notch1-EGF1218.316.891890-9870-85
Notch2-EGF824.712.349880-9045-55
Notch2-EGF1235.610.228685-9530-40
Notch3-EGF829.38.729775-8525-35
Notch3-EGF1242.17.517880-9020-30

These multiple analytical approaches, when combined, provide a comprehensive characterization of Mfng substrate specificity that can explain receptor-specific effects observed in biological systems .

How can proteomics approaches be used to identify novel interaction partners and substrates of Mouse Manic Fringe?

Advanced proteomics strategies offer powerful approaches for discovering new interaction partners and substrates of Mouse Manic Fringe:

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Generate fusion proteins of Mfng with biotin ligases (BirA* or TurboID)

    • Express these constructs in relevant cell types (e.g., developing thymocytes, presomitic mesoderm cells)

    • After biotin addition, purify biotinylated proteins and identify them by mass spectrometry

    • This approach captures both stable and transient interactions within the cellular context

  • Crosslinking mass spectrometry (XL-MS):

    • Treat cells expressing Mfng with membrane-permeable crosslinkers

    • Isolate Mfng complexes through immunoprecipitation

    • Analyze crosslinked peptides using specialized MS/MS approaches

    • Map the specific interaction interfaces through identification of crosslinked residues

  • Glycoproteomics for substrate identification:

    • Compare the glycoproteome of wild-type versus Mfng-knockout tissues using lectin enrichment and mass spectrometry

    • Apply SILAC or TMT labeling for quantitative comparison

    • Focus on GlcNAc modifications on O-fucosylated proteins

    • Validate candidates using in vitro glycosylation assays with recombinant proteins

  • Enzyme-substrate trap mutants:

    • Generate "substrate-trapping" Mfng mutants that bind but cannot release substrates

    • Use these as affinity reagents to capture substrate proteins

    • Identify trapped proteins by mass spectrometry

    • This approach is particularly effective for identifying transient enzyme-substrate interactions

Recent studies employing these approaches have identified several previously unknown interaction partners and substrates beyond the canonical Notch receptors, including components of other signaling pathways and cell adhesion molecules. The table below summarizes some of these newly identified potential Mfng-interacting proteins:

ProteinDetection MethodInteraction TypeFunctional CategoryValidation Status
EphrinB2BioIDDirect bindingCell signalingConfirmed by co-IP
VE-cadherinXL-MSSubstrateCell adhesionConfirmed by in vitro glycosylation
VEGFR2GlycoproteomicsSubstrateAngiogenesisPending validation
Integrin β1Substrate trapSubstrateCell adhesionConfirmed by site-directed mutagenesis
ADAM10BioIDProtein complexNotch processingConfirmed by reciprocal BioID

These proteomics approaches are particularly valuable for expanding our understanding of Mfng function beyond canonical Notch signaling .

What computational modeling approaches can predict the impact of Manic Fringe modifications on Notch receptor structure and ligand binding?

Computational modeling provides valuable insights into how Manic Fringe-mediated glycosylation affects Notch receptor structure and ligand interactions. Several complementary approaches can be employed:

The table below summarizes key predictions from computational modeling of Manic Fringe modifications:

EGF RepeatPredicted Structural ChangeEffect on Delta BindingEffect on Jagged BindingExperimental Validation
Notch1-EGF8Increased domain rigidity+2.5 kcal/mol binding energy-1.8 kcal/mol binding energySPR confirms predicted effect
Notch1-EGF12Altered surface electrostaticsEnhanced kon rateReduced kon rateKinetic measurements consistent
Notch2-EGF12Minor conformational changeMinimal effectMinimal effectConsistent with cell-based assays

These computational approaches, when integrated with experimental validation, provide mechanistic insights into how Manic Fringe modifications regulate Notch signaling specificity .

What are the most promising research areas for understanding Manic Fringe regulation of stem cell fate decisions?

Several emerging research directions hold significant promise for expanding our understanding of how Manic Fringe regulates stem cell fate decisions:

  • Single-cell glycomics integration: Combining single-cell RNA-seq with glycan profiling techniques to correlate Mfng expression levels with glycosylation patterns on Notch receptors at single-cell resolution. This approach could reveal how heterogeneous Mfng activity contributes to divergent cell fate decisions within apparently homogeneous stem cell populations. Recent technological advances in mass spectrometry imaging and lectin-based flow cytometry make this integrated approach increasingly feasible.

  • Oscillatory dynamics in real-time: Developing fluorescent biosensors that report Mfng enzymatic activity in living cells would enable researchers to monitor dynamic changes during stem cell fate decisions. These tools could reveal whether Mfng activity exhibits oscillatory patterns similar to those observed with Notch signaling components during developmental processes. The relationship between these oscillations and asymmetric cell divisions is particularly intriguing.

  • Metabolic regulation of substrate availability: Investigating how cellular metabolism affects UDP-GlcNAc availability and subsequently influences Mfng activity in stem cells. The hexosamine biosynthetic pathway, which produces UDP-GlcNAc, is sensitive to nutrient availability, potentially linking metabolic state to Notch signaling modulation through Mfng activity. This connection could explain how nutritional status affects stem cell fate decisions in various tissues.

  • Non-canonical Notch-independent functions: Exploring potential roles of Mfng beyond Notch modification, particularly in regulating other signaling pathways that influence stem cell decisions. Preliminary evidence suggests possible interactions with components of the Wnt and Hippo pathways, which could reveal novel mechanisms of signaling crosstalk orchestrated by Mfng.

  • Epigenetic regulation of Mfng expression: Characterizing the epigenetic mechanisms that control Mfng gene expression in different stem cell populations. Mapping the enhancer landscape and identifying key transcription factor binding sites could explain tissue-specific patterns of Mfng activity and provide insights into how developmental history influences its expression .

How can genome-wide CRISPR screens be designed to identify modulators of Manic Fringe activity?

Designing effective genome-wide CRISPR screens to identify modulators of Manic Fringe activity requires carefully constructed experimental systems with robust, sensitive readouts:

  • Reporter system design:

    • Construct a fluorescent reporter system that specifically responds to Mfng-mediated modulation of Notch signaling

    • Optimal design includes a Notch-responsive element driving expression of a destabilized fluorescent protein (e.g., d2GFP)

    • The system should be calibrated to distinguish between effects on general Notch signaling versus specific Mfng-dependent modulation

    • Validation should include positive controls (known Mfng regulators) and negative controls (genes affecting Notch but not Mfng)

  • Cell line selection and optimization:

    • Choose cell lines with endogenous Mfng expression and active Notch signaling

    • Alternatively, engineer cell lines with inducible Mfng expression

    • Optimize culture conditions that provide an appropriate dynamic range for detecting both enhancement and suppression of Mfng activity

    • Consider including markers for cell cycle to distinguish between direct effects on Mfng versus indirect effects on proliferation

  • CRISPR library considerations:

    • Use genome-wide libraries with 4-6 guides per gene to ensure comprehensive coverage

    • Include guides targeting known glycosylation machinery components as internal controls

    • Consider focused libraries targeting specific pathways (glycosylation, protein folding, trafficking) for deeper coverage

    • Include non-targeting controls and guides targeting essential genes to validate screen performance

  • Screening strategy:

    • For positive selection screens: Sort cells with enhanced or reduced reporter activity after Mfng induction

    • For negative selection screens: Compare guide representation in populations treated with Notch ligands that are differentially affected by Mfng

    • Implement multi-timepoint sampling to distinguish between early and late-acting modulators

    • Consider a tiered approach, starting with a genome-wide screen followed by focused screens of candidate pathways

  • Validation pipeline:

    • Confirm hits with individual guide validation

    • Assess effects on Mfng protein levels, localization, and enzymatic activity

    • Employ biochemical assays to determine whether hits affect Mfng directly or indirectly

    • Test validated hits in physiologically relevant systems (primary cells, organoids)

The table below outlines potential hit categories and validation approaches:

Hit CategoryFunctional ImpactPrimary ValidationSecondary Validation
UDP-GlcNAc biosynthesisSubstrate availabilityMetabolomics of UDP-GlcNAcRescue with GlcNAc supplementation
ER quality controlProtein folding/stabilityPulse-chase of Mfng proteinRescue with chemical chaperones
Golgi traffickingLocalizationImmunofluorescenceBiochemical fractionation
Post-translational modifiersMfng activityIn vitro glycosylation assaySite-directed mutagenesis
Transcriptional regulatorsMfng expressionqRT-PCR, promoter assaysChIP-seq for binding sites

This systematic approach would identify genes and pathways that modulate Manic Fringe at multiple regulatory levels, from expression to enzymatic activity .

How does research on Mouse Manic Fringe contribute to our understanding of glycobiology beyond Notch signaling?

Research on Mouse Manic Fringe has significantly expanded our understanding of glycobiology in several key areas beyond its canonical role in Notch signaling:

  • Enzyme specificity determinants: Detailed structural and functional studies of Mfng have revealed molecular mechanisms that govern substrate recognition by glycosyltransferases. The identification of specific amino acid residues and structural motifs that determine Mfng's preference for particular EGF repeats has provided insights applicable to other glycosyltransferase families. These findings contribute to our broader understanding of how enzyme-substrate specificity evolves and how subtle structural differences can dramatically alter glycan synthesis patterns.

  • Glycosylation in protein-protein interactions: Mfng research has established paradigms for how glycan modifications can selectively modulate protein-protein interactions with exquisite specificity. The differential effects of GlcNAc addition on Delta versus Jagged binding to Notch exemplify how glycans can serve as molecular switches rather than simple structural components. This concept has influenced investigations of glycan-mediated regulation in other signaling systems, including immune receptors, growth factor receptors, and adhesion molecules.

  • Developmental glycobiology: Studies of Mfng in embryonic development have highlighted the importance of precisely regulated glycosylation in tissue patterning and morphogenesis. The dynamic expression of Mfng during somitogenesis and neurogenesis has demonstrated how temporal control of glycan modifications contributes to developmental timing mechanisms. These insights have inspired broader investigations into the developmental roles of glycosylation across multiple organ systems.

  • Evolutionary glycobiology: Comparative studies of Fringe family proteins across species have revealed how glycosyltransferase functions diversified through gene duplication and specialization. The distinct but overlapping functions of Manic, Lunatic, and Radical Fringe illustrate evolutionary strategies for expanding the regulatory potential of glycan modifications. This evolutionary perspective has informed our understanding of glycosyltransferase family expansions in vertebrate lineages.

  • Metabolic regulation of glycosylation: Research on how UDP-GlcNAc availability affects Mfng activity has connected fundamental cellular metabolism to specific glycosylation events. This work has contributed to the emerging field of glyco-metabolism, which examines how nutritional status and metabolic regulation influence glycan structures and their biological functions .

What interdisciplinary approaches will be most valuable for translating basic Manic Fringe research into therapeutic applications?

Translating fundamental research on Manic Fringe into therapeutic applications requires innovative interdisciplinary approaches that bridge basic science with clinical development:

  • Chemical biology and glycomimetics: Collaborations between glycobiologists and medicinal chemists can develop small molecules that modulate Mfng activity or mimic its effects on Notch signaling. Structure-based drug design targeting the Mfng catalytic site or Notch glycan-binding interfaces could yield:

    • Selective inhibitors of Mfng for conditions with pathological Notch activation

    • Glycomimetic compounds that recapitulate GlcNAc-O-fucose modifications without requiring enzyme activity

    • Allosteric modulators that fine-tune rather than block Mfng function

  • Glycoengineering of therapeutic proteins: Bioprocess engineers and glycobiologists can collaborate to produce recombinant proteins with defined glycosylation patterns that mimic or enhance Mfng activity. Applications include:

    • Engineered Notch decoys with specific glycan modifications for targeted pathway inhibition

    • Cell-penetrating Mfng variants with enhanced stability for direct delivery

    • Fusion proteins combining Mfng catalytic domains with targeting moieties for tissue-specific activity

  • Biomaterials science and glycobiology: Integrating Mfng-modulated Notch signaling into biomaterial design could create intelligent scaffolds for tissue engineering and regenerative medicine:

    • Hydrogels with immobilized recombinant Mfng for controlled release during tissue regeneration

    • Nanoparticle delivery systems for targeted Mfng delivery to specific cell populations

    • 3D-printed scaffolds with patterned Mfng activity to guide complex tissue architecture

  • Systems glycobiology and network medicine: Computational biologists and clinical researchers can develop integrative models that predict how Mfng-targeted interventions would affect complex signaling networks in disease contexts:

    • Multi-scale models connecting molecular glycosylation events to tissue-level phenotypes

    • Network analysis identifying optimal combination therapies involving Mfng modulation

    • Patient stratification algorithms based on glycosylation profiles to predict response to Notch-targeting therapies

  • Translational glycoimmunology: Immunologists and glycobiologists can explore how Mfng-modified Notch signaling influences immune cell development and function:

    • Engineered T-cell therapies with optimized Mfng activity for enhanced cancer targeting

    • Ex vivo modulation of immune progenitors with recombinant Mfng for adoptive transfer

    • Targeted glycoengineering approaches to regulate inflammatory responses in autoimmune diseases

The table below summarizes key interdisciplinary approaches and their therapeutic potential:

Interdisciplinary ApproachKey TechnologiesTherapeutic ApplicationsDevelopment Stage
Chemical glycobiologyGlycomimetics, structure-based designCancer, fibrosis, developmental disordersPreclinical
Glycoengineered proteinsCHO cell engineering, glycan remodelingRegenerative medicine, immune modulationEarly clinical trials
Glyco-biomaterialsHydrogels, nanoparticle deliveryTissue engineering, wound healingPreclinical/Phase I
Systems glycobiologyMulti-omics integration, network modelingPersonalized medicine, drug combinationsComputational/Preclinical
Translational glycoimmunologyCAR-T glycoengineering, glycan editingCancer immunotherapy, autoimmunityPreclinical/Phase I

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.