Recombinant Mouse Beta-tectorin (Tectb)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Mouse Tectb (UniProt: O08524) corresponds to residues 18–305 of the mature protein fused with an N-terminal 6xHis tag . Key characteristics include:

PropertyDetail
Molecular Weight36.5 kDa (theoretical); ~38 kDa observed (SDS-PAGE, glycosylated)
Purity>90% (SDS-PAGE)
Expression SystemE. coli
Storage StabilityLiquid: 6 months at -20°C/-80°C; Lyophilized: 12 months
Sequence288-amino-acid chain with a zona pellucida (ZP) domain

Role in the Tectorial Membrane

  • Tectb is a major component of the TM’s striated-sheet matrix, which embeds collagen fibrils and interfaces with hair cell stereocilia to transduce sound .

  • In Tectb-deficient mice, the TM’s collagen organization becomes disordered, reducing auditory sensitivity and altering frequency selectivity .

Mutational Studies

  • Deletion of Tectb disrupts TM traveling wave propagation, impairing cochlear amplification .

  • Compound mutations (e.g., Tecta/b double knockouts) cause collagen fibril misalignment and abnormal TM layering, leading to hearing deficits .

Experimental Uses

  • Antibody Production: Used to generate polyclonal antibodies for Western blot (WB), immunohistochemistry (IHC), and immunoprecipitation (IP) .

  • Structural Studies: Key for investigating TM mechanics, including collagen fibril orientation and glycoprotein interactions .

Key Findings from Mouse Models

PhenotypeWild-Type TMTectb-Deficient TM
Collagen Fibril AlignmentApical-to-basal orientation Disorganized bundles with basal tilt
Auditory SensitivityNormal thresholds Elevated thresholds (20–40 dB loss)
TM Surface StructuresIntact covernet fibrils Absent/reduced electron-dense cords

Reconstitution and Handling

  • Buffer: Tris/PBS-based with 50% glycerol (liquid) or 6% trehalose (lyophilized) .

  • Reconstitution: Dilute in sterile water to 0.1–1.0 mg/mL; aliquot to avoid freeze-thaw cycles .

Quality Control

  • Validated via reducing SDS-PAGE and mass spectrometry .

  • Glycosylation confirmed by electrophoretic mobility shifts .

Future Directions

Current research focuses on:

  • Mechanistic links between TM nanostructure and cochlear amplification .

  • Developing Tectb-targeted therapies for hereditary hearing loss .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5% to 50% glycerol.
Note: If you have a specific requirement for the glycerol content, please indicate it in your order notes.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.

Description

The cDNA fragment encoding amino acids 18-305 of Mouse Beta-tectorin/Tectb was fused with an N-terminal 6xHis-tag and subsequently expressed in an in vitro E.coli expression system. The resulting product is the recombinant full-length mature Mouse Tectb protein. The purity of this protein was determined using SDS-PAGE and reached up to 90%. On the reducing SDS-PAGE gel, a molecular mass band of approximately 38 kDa is observed. The slightly higher molecular weight is attributed to glycosylation. This recombinant Tectb protein can be utilized for the production of specific antibodies or for research involving the tectorial membrane (TM).

Tectb is a non-collagenous glycoprotein localized to the TM. Its expression is exclusively and highly concentrated in the inner ear. The absence of Tecb impairs the core structure of the TM and significantly alters cochlear function. Mammalian hearing is characterized by remarkable sensitivity and exquisite frequency selectivity. Roozbeh Ghaffari et al. demonstrated that mutations in Tectb lead to a reduction in the spatial extent and propagation velocity of TM traveling waves, which is likely responsible for the hearing abnormalities associated with these mutations. The deletion of the tectb gene in mouse models resulted in decreased sensitivity and sharper frequency selectivity.

Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Synonyms
Tectb; Beta-tectorin
Datasheet & Coa
Please contact us to get it.
Expression Region
18-305aa
Mol. Weight
36.5kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Tectb
Target Protein Sequence
KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
One of the major non-collagenous components of the tectorial membrane. The tectorial membrane is an extracellular matrix located within the inner ear that covers the neuroepithelium of the cochlea and makes contact with the stereocilia bundles of specialized sensory hair cells. Sound stimulates the movement of these hair cells relative to the tectorial membrane, deflecting the stereocilia and leading to fluctuations in hair-cell membrane potential. This process transduces sound into electrical signals.
Database Links
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side. Secreted, extracellular space, extracellular matrix.

Q&A

What is Beta-tectorin and what is its role in cochlear function?

Beta-tectorin is a glycoprotein that localizes to the tectorial membrane (TM) in the cochlea. It plays a crucial role in maintaining the core structure of the TM, which is essential for normal hearing function. The TM functions as a mechanical coupling between the motion of the basilar membrane and the deflection of stereocilia on hair cells. Beta-tectorin specifically contributes to the wave propagation properties of the TM, affecting both sensitivity and frequency selectivity in mammalian hearing .

Functionally, Beta-tectorin helps coordinate the activities of multiple outer hair cells (OHCs) through TM wave propagation. When this protein is absent (as in Tectb−/− mice), the spatial extent and velocity of TM traveling waves are reduced, leading to significant alterations in hearing sensitivity and frequency selectivity .

How does the Tectb gene mutation affect TM structure and wave propagation?

The deletion of Beta-tectorin in Tectb−/− mice leads to profound structural changes in the TM. These changes include:

  • Disruption of the TM's core structure

  • Reduced spatial extent of TM waves (decreased by approximately 55-75%)

  • Shortened wavelengths (reduced by approximately 20-60%)

  • Decreased propagation velocity of TM traveling waves

These structural alterations significantly impact sound wave transmission across the TM. In basal sections of the cochlea, Tectb−/− TMs show wave decay constants reduced by approximately 55% and wavelengths reduced by approximately 20% compared to wild-type TMs. The effects are even more pronounced in apical segments, where wave decay constants are reduced by approximately 75% and wavelengths reduced by approximately 60% .

What distinguishes Tectb from Tecta in experimental models?

While both Tectb (Beta-tectorin) and Tecta (Alpha-tectorin) are glycoproteins found in the tectorial membrane, they represent distinct genes with different structural and functional roles:

CharacteristicTectaTectb
ProteinAlpha-tectorinBeta-tectorin
LocationThroughout TM corePrimarily in TM core
Mutation effectsCan cause mid-frequency (ZP domain) or high-frequency (ZA domain) hearing lossReduces sensitivity but sharpens frequency selectivity
TM structural changesZP mutations: "hump-backed" shape, disrupted marginal bandDisruption of core structure, altered wave properties
Mouse modelsTectaL1820F,G1824D/+, TectaC1837G/+, TectaC1619S/+Tectb−/−

Tecta mutations can have varying effects depending on the domain affected. For instance, mutations in the ZP domain (as in TectaL1820F,G1824D/+ mice) result in stable mid-frequency hearing loss, while mutations in the ZA domain (as in TectaC1619S/+ mice) cause progressive high-frequency hearing loss .

What are the key considerations when designing experiments with Tectb−/− mouse models?

When designing experiments with Tectb−/− mouse models, researchers should consider:

  • Frequency-dependent effects: The Tectb mutation affects hearing differently across frequency ranges. At mid to high frequencies, it reduces sensitivity by ~10 dB SPL while increasing tuning sharpness by a factor of 2-3. At low frequencies, sensitivity is more severely reduced (~50 dB SPL) .

  • Experimental control selection: True experimental design requires proper control groups with random assignment. For Tectb research, wild-type littermates typically serve as the most appropriate controls to account for genetic background effects .

  • Measurement timing: Decide whether baseline measurements and post-intervention measurements are needed, particularly when studying progressive effects or interventions that might modify Tectb-related phenotypes .

  • Age considerations: Since some TM-related phenotypes can show progressive changes, age-matching between experimental and control groups is critical.

  • Spatial sampling: When examining TM wave properties, measurements should be taken from multiple cochlear regions (apical, middle, and basal) as the effects of Tectb deletion vary significantly along the cochlear length .

How should researchers confirm successful Tectb gene targeting in experimental models?

Verification of successful Tectb gene targeting should follow a multi-step approach:

  • Southern blotting: To screen for correctly targeted recombinant clones after electroporation of linearized targeting constructs into mouse ES cells. This confirms proper integration of the construct at the genomic level .

  • PCR verification: Following removal of selection cassettes (such as Neo R) by Cre-mediated recombination, PCR should be used to confirm proper deletion .

  • RT-PCR and sequencing: Directly sequence RT-PCR products to confirm the presence of the desired point mutations in Tectb transcripts .

  • Immunofluorescence microscopy: Examine cochlear cryosections to verify altered distribution of Tectb protein in the tectorial membrane. This should be compared with the distribution of other TM proteins such as Tecta and glycoconjugates recognized by soybean agglutinin (SBA) .

  • Electron microscopy: For detailed analysis of TM ultrastructure, confirming the expected structural changes resulting from Tectb mutation .

What methods are most effective for measuring TM wave properties in Tectb−/− mice?

For accurate measurement of TM wave properties in Tectb−/− mice, the following methodological approaches are recommended:

  • Optical imaging of isolated TM segments: Excise TM segments from different cochlear regions and mount them in fluid chambers for imaging of wave propagation. This allows direct visualization of traveling waves under controlled conditions .

  • Radial motion tracking: Capture snapshots of radial motion along TM segments at specific phases of periodic driving signals. This enables quantification of wavelength and decay constants .

  • Frequency-specific stimulation: Apply stimuli across a range of frequencies (e.g., from low to high, 1-20 kHz) to characterize frequency-dependent effects on wave propagation .

  • Comparative analysis: Always perform parallel measurements on age-matched wild-type TMs to enable direct comparison of wave parameters.

  • Wave parameter calculations: Calculate key parameters including:

    • Wave decay constants (spatial extent)

    • Wavelengths

    • Propagation velocities

    • Phase relationships

Representative measurements from basal TM segments show that at 18 kHz, Tectb−/− TMs have wave decay constants reduced by ~55% and wavelengths reduced by ~20% compared to wild-type TMs .

How do changes in TM wave properties in Tectb−/− mice explain the paradoxical hearing phenotype?

The Tectb−/− mouse model presents a seemingly paradoxical hearing phenotype: decreased sensitivity coupled with sharpened frequency selectivity. This contradicts conventional models where these properties are typically linked (improved sensitivity usually accompanies improved frequency selectivity). This paradox can be explained by analyzing the specific changes in TM wave properties:

  • Reduced spatial extent of TM waves: The shorter decay constants of TM waves in Tectb−/− mice (reduced by 55-75%) decrease the spread of excitation along the cochlea. This reduction in spatial coupling between adjacent regions results in narrower frequency tuning, explaining the increased frequency selectivity .

  • Decreased propagation velocity: The reduced TM wave velocity in Tectb−/− mice limits the number of outer hair cells (OHCs) that effectively couple energy to the basilar membrane. This reduced coupling results in decreased amplification efficacy, explaining the reduction in sensitivity .

  • Frequency-dependent effects: At low frequencies, the TM wave velocity reduction is even more pronounced, explaining the more dramatic loss of sensitivity (~50 dB SPL) in the low-frequency range compared to the modest reduction (~10 dB SPL) at mid-to-high frequencies .

This case demonstrates that TM waves serve as a mechanism to balance sensitivity and frequency selectivity in cochlear function, with Tectb playing a critical role in this balance.

What insights do comparative studies between Tectb and Tecta mutants provide for understanding TM function?

Comparative analysis of Tectb−/− and various Tecta mutant mice provides crucial insights into the differential roles of these proteins in TM function:

ParameterTectb−/−TectaL1820F,G1824D/+ (ZP)TectaC1837G/+ (ZP)TectaC1619S/+ (ZA)
Hearing lossReduced sensitivity with sharpened tuningStable mid-frequency loss (30-40 dB)Stable mid-frequency loss (30-40 dB)Progressive high-frequency loss (20-30 dB)
TM structureReduced wave propagation"Hump-backed" shape, reduced limbal zone"Hump-backed" shape, reduced limbal zoneDistorted cross-section, disrupted marginal band
Tectb distributionAbsentLower in medial sulcal regionLower in medial sulcal regionPresent throughout TM
Collagen fibril organizationAlteredReduced, convoluted, mesh-like patternReduced, convoluted, mesh-like patternMinimally affected
Marginal bandAffectedDisplaced mediallyDisplaced mediallyDisrupted

These comparative studies reveal that:

How can researchers leverage Tectb−/− models to study cochlear amplification mechanisms?

The Tectb−/− mouse model offers unique opportunities to dissect cochlear amplification mechanisms:

  • Decoupling sensitivity and frequency selectivity: Unlike most cochlear manipulations that affect both properties in the same direction, Tectb−/− mice allow researchers to study these properties independently, providing a unique window into their underlying mechanisms .

  • Investigating spatial coupling: By studying how the reduced spatial extent of TM waves affects hair cell coordination, researchers can determine the optimal degree of spatial coupling for different aspects of hearing function .

  • Frequency-specific experimental designs: The differential effects at low versus mid-high frequencies make this model valuable for studying frequency-dependent amplification mechanisms. This can be approached by:

    • Comparing responses to frequency-specific stimuli

    • Analyzing differences in mechanical responses along the cochlear length

    • Correlating wave propagation parameters with physiological measurements

  • Isolating TM-specific contributions: Since the primary defect is in the TM rather than in hair cells or other cochlear structures, researchers can isolate the TM's specific contribution to cochlear amplification.

  • Combining with other genetic models: Cross-breeding Tectb−/− mice with other mutants affecting hair cell function can help dissect the interactions between TM mechanics and hair cell physiology in the amplification process.

How should researchers address variability in phenotypic expression in Tectb−/− mice?

When working with Tectb−/− mice, researchers may encounter variability in phenotypic expression. To address this challenge:

  • Increase sample size: Ensure sufficient statistical power by including adequate numbers of animals in both experimental and control groups.

  • Control for genetic background: Maintain consistent genetic backgrounds and use littermate controls whenever possible to minimize the impact of modifier genes.

  • Age stratification: Group animals by precise age ranges, as TM properties may change during development and aging.

  • Standardize measurement methods: Develop rigorous protocols for tissue preparation, experimental conditions, and data analysis to reduce technical variability.

  • Cochlear location mapping: Precisely document the cochlear location of all measurements, as effects vary significantly along the cochlear length .

  • Multi-parameter analysis: Assess multiple parameters (wave decay, wavelength, velocity) rather than relying on single measures, as the relationship between parameters may be more consistent than individual values.

What are the key considerations when interpreting contradictory data from in vitro versus in vivo Tectb studies?

When faced with contradictions between in vitro and in vivo findings in Tectb research, consider:

  • Mechanical loading differences: The in vivo TM is mechanically loaded by surrounding structures, while isolated TM segments used in vitro lack these interactions. This may significantly affect wave propagation properties .

  • Ionic environment: The ionic composition of endolymph in vivo differs from typical experimental solutions, potentially affecting TM mechanical properties.

  • Temperature effects: Most in vitro measurements are conducted at room temperature rather than body temperature, which can affect protein interactions and mechanical properties.

  • Dynamic versus static measurements: In vivo measurements capture dynamic responses to sound, while many in vitro measurements assess static properties or responses to artificial stimulation.

  • Integration with active processes: In vivo, the TM interacts with actively motile outer hair cells, a factor typically absent in isolated TM preparations.

When contradictions arise, researchers should:

How can researchers effectively combine molecular, structural, and functional data in Tectb studies?

An integrative approach to Tectb research requires thoughtful combination of data from different experimental domains:

  • Establish clear correlations: Directly correlate molecular changes (e.g., protein composition) with structural alterations (e.g., TM wave properties) and functional outcomes (e.g., auditory brainstem responses).

  • Use consistent samples: When possible, perform multiple analyses on tissues from the same animals to enable direct correlation across methodologies.

  • Develop multi-scale models: Create computational models that integrate molecular interactions, tissue mechanics, and system-level function to predict how molecular changes propagate to functional effects.

  • Standardize quantification: Develop standardized metrics for each level of analysis to facilitate comparison:

    • Molecular: protein expression levels, distribution patterns

    • Structural: wave parameters, TM dimensions

    • Functional: sensitivity thresholds, tuning sharpness

  • Temporal sequencing: When studying progressive changes, establish the temporal sequence of alterations at molecular, structural, and functional levels to understand causal relationships.

By integrating data across these domains, researchers can develop comprehensive models of how Tectb influences hearing through its effects on TM structure and mechanics, ultimately advancing our understanding of the molecular basis of cochlear function .

What therapeutic applications might emerge from understanding Tectb function in the tectorial membrane?

Understanding Beta-tectorin's role in tectorial membrane function could lead to several therapeutic approaches:

  • Gene therapy strategies: Development of targeted gene therapies to restore or modify Tectb expression in cases where TM dysfunction contributes to hearing loss.

  • Biomimetic TM materials: Engineering of artificial TM materials with tunable wave propagation properties based on insights from Tectb−/− models, potentially for use in cochlear implant interfaces.

  • Frequency-specific interventions: Creation of interventions that target specific frequency ranges based on the differential effects of Tectb on low versus high-frequency hearing.

  • Balance modulation therapies: Development of approaches to optimize the balance between sensitivity and frequency selectivity in hearing disorders where this balance is disrupted.

  • Combination approaches: Integration of TM-targeted therapies with hair cell regeneration or protection strategies for comprehensive hearing restoration.

These applications would build directly on the findings that Tectb influences both the structure of the TM and its wave propagation properties, which are critical determinants of hearing function .

How can recombinant Tectb protein be effectively used in experimental studies?

Recombinant Tectb protein can serve as a valuable tool in research, with several methodological considerations:

  • Protein design considerations: When designing recombinant Tectb proteins, researchers should consider incorporating:

    • Appropriate tags for purification and detection (e.g., His-tags)

    • Linker sequences to maintain protein structure

    • Domain-specific modifications to study structure-function relationships

  • Functional assays: Develop specific assays to assess the binding properties and functional effects of recombinant Tectb, potentially including:

    • Interaction assays with other TM components

    • Mechanical testing of reconstituted TM-like matrices

    • Cell-based assays to assess effects on hair cell function

  • Reconstitution studies: Use purified recombinant Tectb to reconstitute TM-like structures in vitro, allowing manipulation of composition to study how Tectb contributes to mechanical properties.

  • In vivo applications: Consider direct application of recombinant Tectb to cochlear explants or in vivo cochlear preparations to assess rescue of Tectb−/− phenotypes or modification of wild-type function.

  • Quality control: Implement rigorous quality control measures, including verification of proper folding, glycosylation status assessment, and functional validation before experimental use .

What novel experimental approaches could advance our understanding of Tectb's role in hearing mechanisms?

Several innovative approaches could significantly advance Tectb research:

  • Single-cell transcriptomics: Apply single-cell RNA sequencing to identify compensatory gene expression changes in Tectb−/− models, potentially revealing new molecular players in TM function.

  • In situ mechanical measurements: Develop techniques for measuring TM mechanical properties in the intact cochlea, ideally during sound stimulation, to better understand the in vivo consequences of Tectb deletion.

  • Optogenetic manipulation: Use optogenetic approaches to manipulate hair cell function in Tectb−/− models, enabling precise control of cochlear amplification independent of TM effects.

  • Cryo-electron microscopy: Apply cryo-EM to study the molecular structure of the TM, including how Tectb contributes to the organization of other TM components.

  • Tissue-specific conditional knockouts: Develop conditional Tectb knockout models that allow temporal control of Tectb expression to study its role during development versus mature function.

  • Computational modeling: Create detailed computational models of TM wave propagation that incorporate molecular-scale interactions to predict how specific changes to Tectb would affect hearing function.

  • Multi-modal imaging: Combine techniques such as optical coherence tomography, confocal microscopy, and high-speed video microscopy to simultaneously capture structural and functional data from the same TM preparations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.