Recombinant Mouse Bifunctional apoptosis regulator (Bfar)

Shipped with Ice Packs
In Stock

Description

Production and Validation

The recombinant protein is synthesized via codon-optimized E. coli expression systems, followed by affinity chromatography and lyophilization . Key validation steps include:

  • Immunoblotting: Monoclonal antibodies confirm the absence of degradation products .

  • Functional assays: Demonstrates binding to PNPLA3 (a lipid metabolism protein) and promotes its ubiquitination in vitro .

Apoptosis Regulation

  • Inhibition of intrinsic/extrinsic pathways: Bfar binds Bcl-2/Bcl-XL via its SAM domain and Caspase-8 via a pseudo-DED motif, sequestering pro-apoptotic signals .

  • ER stress protection: Overexpression in neuronal cells reduces thapsigargin-induced apoptosis by 40–60% compared to controls .

Ubiquitin Ligase Activity

  • Substrate targeting: BFAR mediates K63-linked ubiquitination of TGFβR1 (enhancing Th9 differentiation) and PNPLA3 (promoting its proteasomal degradation) .

  • Structural basis: AlphaFold modeling predicts re-entrant helices in the C-terminal region critical for substrate recognition .

Table 2: Key Interactions and Outcomes

SubstrateInteraction TypeBiological OutcomeCitation
PNPLA3Ubiquitination (K268)Accelerates PNPLA3 degradation; reduces hepatic steatosis in mice
TGFβR1K63-linked ubiquitinationEnhances TGFβ signaling and Th9 cell differentiation
Caspase-8Pseudo-DED bindingInhibits Fas-induced apoptosis

Applications in Research

  • Mechanistic studies: Used to dissect ER stress responses and apoptosis in neuronal/immune cells .

  • Therapeutic development: Overexpression in Th9 cells enhances anti-tumor immunity and checkpoint inhibitor efficacy .

  • Metabolic disease models: Bfar knockout mice exhibit doubled hepatic PNPLA3 levels, mimicking human fatty liver disease .

Limitations and Considerations

  • Species specificity: BFAR’s interaction with BI-1 (an ER stress regulator) observed in human cells is absent in mice, suggesting context-dependent roles .

  • Storage stability: Repeated freeze-thaw cycles reduce activity; aliquoting in glycerol is recommended .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
All proteins are shipped with standard blue ice packs unless otherwise specified. For dry ice shipping, please communicate your requirement in advance. Additional fees may apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
Bfar; Bifunctional apoptosis regulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Bfar
Target Protein Sequence
MEEPQKNDLSMREQEEEHPVRSSGPQISVSEFSCHCCYDTLVNPTTLNCGHSFCRHCLAL WWMSSKKTECPECREKWEGFPKVNILLRDAIEKLFPDAIRMRVEDIQQNNDVVQSLAAFQ KYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVILLVYHWRSRESEHGLLVHKAVD KWTMEEVVLWLEQLGPWASLYRDRFLSERVNGRLLLTLTEEEFSRAPYTIENSSHRRVIL TELERVRALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLGLLYLYLFDYTDCFLPFIH TICPLQENSSGEDIFTKLLDLREPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR FLIVNAVLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFMAMFWPLIPQFVCN CLFYWALYFNPIINIDLVVKEVRRLETQVL
Uniprot No.

Target Background

Function
Bifunctional apoptosis regulator (Bfar) is an apoptosis regulator with anti-apoptotic activity, effectively preventing apoptosis triggered both via death receptors and mitochondrial factors.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the domain structure of mouse Bifunctional apoptosis regulator?

Mouse Bfar contains multiple functional domains that contribute to its role in apoptosis regulation. The protein has:

  • An N-terminal RING domain that transfers ubiquitin from E2 ligases to target substrates

  • A Sterile Alpha Motif (SAM) domain that mediates protein-protein interactions and potential dimerization

  • Multiple transmembrane helices (TMHs) that anchor the protein in the endoplasmic reticulum membrane

  • Re-entrant helices that enter and exit the membrane from the same side

  • A region previously reported to share features with Death Effector Domains (DED), though recent structural modeling suggests this region may not adopt a true death domain fold

The RING domain is positioned on the opposite side of the membrane from the SAM domain, creating a bifunctional topology that enables Bfar to interact with proteins in different cellular compartments simultaneously .

Where is Bfar primarily expressed in mouse tissues?

Immunoblot analysis of normal tissues demonstrates that Bfar is highly expressed in the brain compared to low or absent expression in other organs. Within the central nervous system, immunohistochemical staining reveals that Bfar protein is predominantly expressed by neurons . This distinct expression pattern suggests Bfar may play a particularly important role in neuronal survival and function.

What is the subcellular localization of Bfar?

Immunofluorescence microscopy indicates that Bfar primarily localizes to the endoplasmic reticulum (ER) of cells . This localization is consistent with its structure as an ER-associated protein with multiple transmembrane domains. The membrane topology of Bfar positions its functional domains on different sides of the ER membrane, allowing it to integrate signals between compartments and participate in both ER-associated and cytosolic apoptotic pathways.

How does Bfar inhibit Bax-induced apoptosis?

Bfar was originally identified using a yeast-based screen for inhibitors of Bax-induced cell death. Experimental evidence shows that Bfar can suppress Bax-induced apoptosis in both yeast and mammalian cell systems. Co-transfection studies in 293T cells (which have low endogenous Bfar levels) demonstrated that both wild-type Bfar and Bfar(ΔR) (lacking the RING domain) effectively suppressed Bax-induced apoptosis without interfering with Bax protein production .

Interestingly, the transmembrane domain of Bfar is required for this anti-apoptotic function, as Bfar(ΔTM) was ineffective at suppressing Bax-induced apoptosis despite being produced at similar levels to full-length Bfar in cells . While Bfar does not directly associate with Bax (or the related protein Bak), it does interact with anti-apoptotic Bcl-2 family members, suggesting it may modulate apoptotic pathways indirectly through these interactions.

What are the key protein interactions of Bfar in apoptotic pathways?

Coimmunoprecipitation assays have demonstrated that Bfar specifically associates with:

  • Anti-apoptotic Bcl-2 and Bcl-XL proteins with efficiency comparable to Bax interactions

  • Several proteins potentially involved in neuronal apoptosis regulation, including:

    • Huntingtin Interacting Protein 1 (HIP1)

    • Hippi (Huntingtin Interacting Protein 1 Interactor)

    • Bap31 (B-cell receptor-associated protein 31)

These interactions suggest Bfar functions as a scaffold protein that can modulate multiple apoptotic pathways and potentially link different death signaling mechanisms within the cell.

What is the neuroprotective function of Bfar?

Overexpression of Bfar in CSM 14.1 neuronal cells provides significant protection against a broad range of cell death stimuli, including:

  • Agents that activate mitochondrial apoptotic pathways

  • TNF-family death receptor signaling

  • ER stress-induced cell death

Conversely, downregulation of Bfar by antisense oligonucleotides sensitizes neuronal cells to apoptosis induction . This broad protective effect, combined with Bfar's high expression in neurons, suggests it plays a critical role in promoting neuronal survival by antagonizing diverse cell death pathways. This may be particularly important given that neurons are post-mitotic cells that must survive for the organism's entire lifetime.

What are effective methods for studying Bfar's E3 ubiquitin ligase activity?

Bfar functions as a membrane-bound E3 ubiquitin ligase through its N-terminal RING domain. To study this activity:

  • In vitro ubiquitination assays: Reconstitute the ubiquitination cascade using:

    • Purified recombinant Bfar (full-length or RING domain)

    • E1 activating enzyme and appropriate E2 conjugating enzyme

    • Ubiquitin (can use tagged versions for detection)

    • ATP regenerating system

    • Potential substrate proteins

  • Cell-based degradation assays: Recent studies demonstrated Bfar promotes degradation of PNPLA3, providing a model system to study its E3 ligase activity .

    • Express Bfar and potential substrate in cells

    • Track substrate levels with and without proteasome inhibitors

    • Perform cycloheximide chase to measure protein half-life

    • Conduct ubiquitination assays with immunoprecipitation of substrates

  • Domain mutation analysis: Create point mutations in the RING domain (particularly zinc-coordinating residues) to abolish E3 ligase activity without disrupting protein structure, allowing separation of ubiquitin ligase functions from other scaffolding roles.

How can I design experiments to investigate Bfar's membrane topology?

Based on computational topology predictions, Bfar has a complex membrane structure with multiple transmembrane helices. To experimentally verify this topology:

  • Protease protection assays: Express epitope-tagged versions of Bfar with tags at different predicted locations, then treat microsomes with proteases to determine which regions are protected by the membrane.

  • Glycosylation site mapping: Introduce artificial N-glycosylation sites at various positions and assess glycosylation status to determine luminal versus cytosolic orientation.

  • Fluorescence-based approaches: Use split GFP complementation or bimolecular fluorescence complementation (BiFC) to verify the orientation of specific domains.

  • Cysteine accessibility methods: Introduce cysteine residues at positions of interest and test their accessibility to membrane-impermeable thiol-reactive reagents.

The structural model from AlphaFold predictions suggests interactions between re-entrant helices and transmembrane domains that could be validated through targeted mutagenesis .

What cell models are most appropriate for studying mouse Bfar function?

Based on the research findings, appropriate cell models include:

  • Neuronal cell lines: Given Bfar's high expression in neurons, neuronal cell lines like CSM 14.1 (used in previous studies) are particularly relevant . Other options include:

    • Primary mouse neuronal cultures

    • Neuroblastoma cell lines (N2a, Neuro-2a)

    • Differentiated PC12 cells

    • Neural stem cell-derived neurons

  • HEK293T cells: These cells have low endogenous Bfar levels, making them suitable for gain-of-function experiments through transfection of Bfar constructs .

  • Yeast models: Bfar was originally identified in a yeast-based screen and can suppress Bax-induced cell death in yeast, providing a simple eukaryotic system for structure-function studies .

When selecting a model system, consider:

  • The specific apoptotic pathway being studied

  • Endogenous Bfar expression levels (may require knockdown or knockout)

  • Transfection/transduction efficiency

  • Compatibility with relevant apoptotic stimuli

How does Bfar interact with both mitochondrial and ER stress apoptotic pathways?

Bfar appears to function at the intersection of multiple apoptotic pathways, making it an intriguing target for comprehensive cell death research. The protein's bifunctional nature allows it to:

  • Interact with Bcl-2 family proteins: Coimmunoprecipitation studies show Bfar associates with anti-apoptotic Bcl-2 and Bcl-XL, potentially enhancing their protective functions against mitochondrial apoptosis .

  • Modulate ER stress responses: Bfar's localization to the ER and protection against ER stress-induced apoptosis suggests it may regulate the unfolded protein response (UPR) or ER-associated degradation (ERAD) pathways .

  • Link different death signaling mechanisms: Through interactions with proteins like Bap31, which can communicate between the ER and mitochondria during apoptosis .

To study these interactions, researchers can:

  • Use fluorescence resonance energy transfer (FRET) to detect direct interactions in live cells

  • Employ proximity ligation assays to confirm protein-protein interactions in situ

  • Analyze changes in protein complex formation under different stress conditions

  • Compare wild-type Bfar with domain-specific mutants to map interaction regions

What are the implications of Bfar research for neurodegenerative disease studies?

The high neuronal expression of Bfar and its broad neuroprotective functions suggest potential relevance to neurodegenerative disease research:

  • Huntington's Disease: Bfar interacts with HIP1 and Hippi, proteins implicated in Huntington's disease pathogenesis . This may provide a mechanistic link between mutant huntingtin and neuronal apoptosis.

  • General neuroprotection: Bfar protects against diverse cell death stimuli, suggesting it may be a broad-spectrum neuroprotective factor that could be targeted therapeutically .

  • ER stress in neurodegeneration: Many neurodegenerative conditions involve ER stress. Bfar's ability to protect against ER stress-induced cell death makes it relevant to diseases where this pathway is implicated, such as Alzheimer's and Parkinson's diseases .

Research approaches may include:

  • Analyzing Bfar expression levels in neurodegenerative disease models

  • Testing whether Bfar overexpression can mitigate neurodegeneration in cellular or animal models

  • Investigating whether disease-associated proteins affect Bfar function or localization

  • Developing small molecules that could enhance Bfar's neuroprotective functions

How does the SAM domain contribute to Bfar function?

The Sterile Alpha Motif (SAM) domain in Bfar likely plays important roles in protein-protein interactions and possibly dimerization. To investigate its specific functions:

  • Structure-function analysis: Generate SAM domain deletions or point mutations to assess effects on:

    • Protein localization

    • Anti-apoptotic activity

    • Interactions with Bcl-2 family proteins

    • E3 ligase function

  • Dimerization studies: Since SAM domains often mediate dimerization in other proteins, assess whether Bfar forms dimers or oligomers through:

    • Size exclusion chromatography

    • Native gel electrophoresis

    • FRET between differently tagged Bfar molecules

    • Analytical ultracentrifugation

  • Interaction screening: Use the isolated SAM domain as bait in yeast two-hybrid or pull-down assays to identify specific interaction partners that might expand our understanding of Bfar's functional network.

How can I reconcile contradictory results when studying Bfar's anti-apoptotic effects?

When facing inconsistent results in Bfar studies, consider these potential explanations and solutions:

  • Cell type differences: Bfar may function differently across cell types due to:

    • Varying levels of endogenous Bfar expression

    • Different complements of interacting proteins

    • Cell type-specific apoptotic mechanisms

    Solution: Include multiple cell types in your studies and clearly document baseline Bfar expression levels.

  • Domain-specific functions: Different domains of Bfar mediate distinct functions:

    • The transmembrane domain is required for Bax antagonism

    • The RING domain mediates E3 ligase activity

    • The SAM domain likely facilitates protein interactions

    Solution: Use domain-specific mutants to dissect which functions are relevant to your specific research question.

  • Apoptotic stimulus differences: Bfar protects against diverse death stimuli , but efficacy may vary:

    Apoptotic StimulusPathwayExpected Bfar Protection
    Bax overexpressionMitochondrialStrong
    Death receptor activationExtrinsicModerate
    ER stress inducersER/UPRModerate to strong
    DNA damagep53-dependentVariable

    Solution: Carefully select apoptotic stimuli relevant to your research question and include appropriate positive controls.

What are critical controls for studying recombinant mouse Bfar?

To ensure robust and reproducible Bfar research, include these essential controls:

  • Expression validation:

    • Confirm protein expression by Western blot with antibodies against Bfar or epitope tags

    • Verify subcellular localization by immunofluorescence (expected ER localization)

    • Check for degradation products or aberrant processing

  • Functional controls:

    • RING domain mutant (C→S substitutions) to abolish E3 ligase activity

    • Transmembrane domain deletion to disrupt ER localization and Bax antagonism

    • SAM domain mutant to disrupt protein interactions

  • Cell death assays:

    • Include both positive controls (known apoptosis inducers) and negative controls

    • Use multiple complementary methods to assess apoptosis (e.g., Annexin V, TUNEL, caspase activation)

    • Confirm that protection is specific to Bfar and not due to general protein overexpression

  • Interaction studies:

    • Include both positive controls (known Bfar interactors like Bcl-2) and negative controls

    • Verify interactions with both co-immunoprecipitation and reverse co-immunoprecipitation

    • Control for non-specific binding to beads or antibodies

How can I optimize expression and purification of recombinant mouse Bfar?

Expressing and purifying full-length Bfar presents challenges due to its multiple transmembrane domains. Consider these approaches:

  • Expression systems options:

    SystemAdvantagesDisadvantages
    E. coliHigh yield, low costPoor folding of membrane proteins
    Insect cellsBetter folding, post-translational modificationsModerate yield, more complex
    Mammalian cellsNative folding environmentLower yield, highest cost
  • Purification strategies:

    • For full-length protein: Detergent solubilization (try mild detergents like DDM or LMNG)

    • For functional domains: Express individual domains (RING, SAM) as soluble proteins

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Use affinity tags positioned to avoid interference with functional domains

  • Activity verification:

    • For full-length Bfar: Reconstitute into liposomes or nanodiscs to restore membrane environment

    • For RING domain: Verify E3 ligase activity with in vitro ubiquitination assays

    • For SAM domain: Test interaction with known binding partners

  • Storage considerations:

    • Full-length protein typically requires detergent or membrane mimetic for stability

    • Individual domains may be more stable in standard buffer conditions

    • Test glycerol, salt concentration, and pH to optimize stability

    • Verify activity after freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.