Recombinant Mouse Blood vessel epicardial substance (Bves)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Bves; Pop1; Popdc1; Blood vessel epicardial substance; mBVES; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Bves
Target Protein Sequence
MNSTESIPLAQSTVAGFTSELESLTPVPSNETTCENWREIHHLVFHVANVCFAVGLLIPT TLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSVFLGINILHLSYLLYKKRPVKI EKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQVYATEDKTSVDDRLSILLKGR MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLCTQISMLEMRNSITSSS DGEDGLHHFLRGSSSTASLPMSSPQQRASAKMKPIEEGVEDDDEVFVSPDALKVHQLP
Uniprot No.

Target Background

Function
Blood Vessel Epicardial Substance (BVES) is a cell adhesion molecule crucial for maintaining cell integrity. It plays a vital role in forming and regulating the tight junction (TJ) paracellular permeability barrier in epithelial cells. BVES is involved in VAMP3-mediated vesicular transport and receptor recycling via its interaction with VAMP3. Furthermore, it modulates cell shape and movement by influencing Rho-family GTPase activity through interaction with ARHGEF25/GEFT. BVES induces initial cell adhesion and aggregation in a calcium-independent manner in epithelial cells. It is also implicated in striated muscle regeneration, cell spreading regulation, and the maintenance of cardiac function. Specifically, it regulates heart rate dynamics, potentially by cAMP binding and increasing cell surface expression of the potassium channel KCNK2, thus enhancing current density. Finally, BVES is a caveolae-associated protein essential for preserving caveolae structural and functional integrity and protecting the heart from ischemic injury.
Gene References Into Functions
  1. BVES is a key regulator of intestinal stem cell programs and mucosal homeostasis. PMID: 26891025
  2. BVES plays a crucial role in maintaining colonic mucosal integrity and protecting against inflammatory carcinogenesis. This research provides in vivo and genetic evidence supporting BVES's regulation of Wnt activity. PMID: 28389570
  3. Bves and NDRG4 regulate directional epicardial cell migration through autocrine extracellular matrix deposition. PMID: 24048452
  4. Popdc1 (a related protein) is a caveolae-associated protein vital for maintaining caveolae structure, function, and cardiac protection. PMID: 24066022
  5. Popdc1 and Popdc2 proteins interact with the potassium channel TREK-1, increasing cell surface expression and current density. PMID: 22354168
  6. Cell surface Bves/Pop1A, comprising an extracellular amino terminus, three transmembrane domains, and a cytoplasmic carboxyl terminus, regulates its cellular distribution during coronary vessel development. PMID: 12815060
  7. Expressed across various epithelial and muscle cells during mouse embryogenesis, suggesting a broad developmental role. PMID: 16538658
  8. Bves directly interacts with GEFT and regulates the Rac1 and Cdc42 signaling cascades. PMID: 18541910
Database Links
Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Tissue Specificity
Expressed in epithelial cells, skeletal muscle, heart and intestinal smooth muscle (at protein level). Expressed in fetal and adult heart and skeletal muscle.

Q&A

What is the molecular structure of mouse BVES and how should researchers analyze its different forms?

Mouse BVES (Blood Vessel Epicardial Substance) is a member of the POP family containing three putative transmembrane domains. When analyzing BVES via Western blot, it typically appears as multiple bands representing different forms:

  • In skeletal muscle: three major bands representing monomers, dimers, and glycosylated forms

  • In heart tissue: two major bands

Methodological approach:

  • Use both reducing and non-reducing SDS-PAGE conditions to distinguish between monomeric and dimeric forms

  • For glycosylation analysis, employ glycosidase treatment prior to Western blotting

  • Include both wild-type and BVES-KO samples to identify non-specific bands

  • Expected molecular weight is approximately 41.5 kDa, but observed weight varies due to post-translational modifications

How does BVES function in skeletal muscle signaling pathways?

BVES functions as a negative feedback regulator of ADCY9-cAMP signaling in skeletal muscle, playing an important role in maintaining muscle homeostasis . Additionally, it serves as a cell adhesion molecule and contributes to vesicular transport.

Methodological approach for investigating BVES function:

  • Measure cAMP levels in WT vs. BVES-KO muscle tissues using ELISA

  • Analyze phosphorylation status of downstream targets in the cAMP pathway

  • Perform co-immunoprecipitation to detect interactions between BVES and signaling components

  • Test the effects of BVES deficiency on muscle performance through:

    • Voluntary wheel running (9 consecutive days)

    • Forced treadmill running tests

    • Measurement of exhaustion time and dropout rates

What phenotypes characterize BVES-knockout mouse models and how should they be measured?

BVES-knockout (BVES-KO) mice display several characteristic phenotypes that should be systematically assessed:

PhenotypeMeasurement MethodKey Findings in BVES-KO Mice
Reduced exercise capacityVoluntary wheel running (9 days)Decreased running distance
Forced treadmill testDecreased total distance and time to exhaustion
Dropout analysisMore dropouts at higher running speeds
Muscular dystrophyHistological analysisDecreased fiber size, increased central nucleation
Body weightWeekly monitoringRetarded body weight gain starting ~3 months of age
Muscle massTerminal tissue collectionDecreased muscle mass

Control considerations:

  • Use age-matched and sex-matched wild-type littermates

  • Include both males and females to assess sex-specific effects

  • Plan longitudinal measurements from 3 months onward

How should researchers design AAV9.BVES gene therapy experiments?

For testing AAV9.BVES therapy in BVES-KO mice, implement the following experimental design:

Vector construction:

  • Place human BVES cDNA fused with 3x HA tag under control of MHCK7 promoter (muscle-specific)

  • Package into AAV9 serotype for efficient muscle targeting

Treatment protocol:

  • Administer via tail vein injection at 2E14 vg/kg

  • Begin treatment at 4 months (post-disease onset)

  • Follow mice until 9 months of age

Outcome measurements:

  • Transgene expression:

    • Western blot analysis of skeletal muscle and heart

    • Immunofluorescence staining with anti-HA antibody

    • Tissue distribution in gastrocnemius, quadriceps, tibialis anterior, diaphragm, soleus, and heart

  • Functional outcomes:

    • Body weight gain

    • Muscle force contractility

    • Exercise performance tests

    • Muscle mass measurements

Expected results:
AAV9.BVES dramatically improves body weight gain, muscle mass, muscle strength, and exercise performance in BVES-KO mice regardless of sex .

How can researchers investigate the BVES-VAMP3 interaction and its role in vesicular transport?

BVES directly interacts with VAMP3, a SNARE protein facilitating vesicular transport of transferrin and β-1-integrin . This interaction appears critical for cell adhesion and motility.

Experimental approaches:

  • Protein interaction studies:

    • Co-immunoprecipitation to confirm direct interaction

    • Map interaction domains using truncation mutants

  • Functional vesicular transport assays:

    • Transferrin recycling assay: Measure uptake of fluorescently labeled transferrin over time

    • β-1-integrin recycling assay: Track internalization and recycling of surface-labeled integrins

    • Compare wild-type cells vs. cells expressing mutated BVES

  • Cell adhesion analysis:

    • Kymographic analysis of cell spreading on fibronectin

    • Quantify cell adhesion dynamics

    • Measure transepithelial resistance for epithelial integrity

  • In vivo validation:

    • Use morpholino knockdown in Xenopus laevis

    • Assess transferrin receptor recycling in animal caps

    • Observe gastrulation defects consistent with impaired integrin-dependent cell movements

How does BVES homodimerization affect its cellular functions?

BVES exists as a dimer or multimer, and this self-association is essential for its function in cell adhesion and maintaining polarity .

Methodological approach:

  • Identify key dimerization motifs:

    • The intracellular KK motif (aa 272, 273) within the conserved popeye domain is necessary for homodimerization

  • Generate and analyze dimerization mutants:

    • Create KK-mut BVES cell lines

    • Compare with wild-type BVES in functional assays

  • Assess phenotypic consequences:

    • Cell aggregation: Wild-type BVES transfected cells form aggregates; KK-mut cells do not

    • Epithelial integrity: KK-mut cells fail to maintain contiguous epithelial sheets

    • Junctional proteins: E-cadherin is mislocalized or downregulated

    • Transepithelial resistance (TER): Greatly reduced in KK-mut cells

    • EMT markers: Decreased cytokeratin expression and upregulated vimentin expression

What are the optimal expression systems for producing recombinant mouse BVES?

Recombinant mouse BVES can be produced in multiple expression systems, each with advantages for different applications:

Expression SystemAdvantagesPurityApplications
E. coliHigh yield, economical>90% by SDS-PAGEStructural studies, antibody production
HEK-293 cellsProper folding and PTMs>90% by Bis-Tris PAGEFunctional studies
Cell-free protein synthesisRapid production>70-80% by SDS PAGEScreening studies
Wheat germAlternative for difficult proteinsNot specifiedSpecialized applications

Purification considerations:

  • Use affinity tags: His-tag, GST-tag, or Strep-tag

  • Employ multi-step purification: affinity chromatography followed by size exclusion

  • Confirm quality by Western blot and analytical SEC (HPLC)

  • Store at -80°C in aliquots to avoid freeze-thaw cycles

What antibody validation steps are essential when studying BVES in mouse models?

Proper antibody validation is critical for reliable BVES detection:

  • Specificity testing:

    • Compare Western blots from wild-type and BVES-KO tissues

    • Identify specific bands (multiple forms of BVES) versus non-specific bands

    • Use recombinant BVES control fragments for blocking experiments

  • Application optimization:

    • For Western blotting: Dilute 1:500-1000

    • For immunofluorescence: Optimize fixation, antigen retrieval, and blocking

  • Controls:

    • Positive control: Recombinant BVES protein

    • Negative control: BVES-KO tissues

    • Pre-absorption control: Incubate antibody with recombinant BVES fragment (100x molar excess) for 30 minutes

How should researchers analyze exercise performance data from BVES-KO mouse studies?

When analyzing exercise performance in BVES studies, follow these analytical approaches:

  • Voluntary wheel running:

    • Plot running distance over 9 consecutive days

    • Calculate both daily and cumulative distances

    • Compare BVES-KO vs. wild-type using repeated measures ANOVA

  • Forced treadmill running:

    • Analyze total running distance

    • Compare time to exhaustion

    • Assess dropout rates at different running speeds using survival analysis

    • Present data as mean ± SEM with individual data points

  • Experimental design considerations:

    • Randomize mice to treatment groups

    • Include appropriate controls (wild-type littermates)

    • Use blinded assessment where possible

    • Follow randomized block design principles to control for environmental variables

How can researchers distinguish between high-quality and low-quality data in BVES studies?

Critical evaluation of data quality in BVES research requires systematic assessment:

  • Data quality indicators:

    • Reproducibility across experimental replicates

    • Appropriate controls (positive, negative, vehicle)

    • Sufficient sample size based on power calculations

    • Blinded analysis to prevent bias

  • Addressing conflicting results:

    • Create comparison tables of experimental conditions

    • Identify key methodological differences

    • Repeat critical experiments using standardized protocols

    • Use multiple complementary approaches

  • Data quality principles:

    • Bad data are not better than no data

    • Data-informed decision-making requires quality controls

    • Biological variations may reflect important differences rather than errors

    • Consistent reporting of both positive and negative results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.