Recombinant Mouse Brain protein 44-like protein (Brp44l)

Shipped with Ice Packs
In Stock

Description

Role in Mitochondrial Metabolism

Brp44l (MPC1) forms a stoichiometric 1:1 complex with MPC2 to facilitate pyruvate entry into mitochondria . This process is essential for:

  • Oxidative Phosphorylation: Enables pyruvate oxidation to acetyl-CoA for the TCA cycle.

  • Metabolic Flexibility: Regulates the balance between aerobic glycolysis and oxidative metabolism .

Key Mechanistic Insights:

  • Heterodimer Formation: MPC1 and MPC2 interact via conserved domains to form a channel-like structure .

  • Regulation: Thiazolidinediones (TZDs), insulin-sensitizing drugs, bind to the MPC complex, highlighting its role in metabolic regulation .

Clinical and Pathological Relevance

Defects in MPC1 (or MPC2) cause mitochondrial pyruvate carrier deficiency (MPYCD), an autosomal recessive disorder characterized by:

  • Symptoms: Lactic acidosis, hypoglycemia, hepatomegaly, and neurological dysfunction .

  • Mouse Models: Studies in mice show that MPC deficiency leads to neuronal hyperexcitability due to impaired calcium homeostasis and reduced mitochondrial ATP production .

ParameterNormal FunctionDeficiency
Pyruvate TransportEfficient mitochondrial uptakeImpaired, leading to cytosolic pyruvate accumulation
Mitochondrial RespirationHigh oxidative phosphorylationReduced OCR, increased glycolysis
Neurological ImpactStable calcium signalingHyperexcitability, epilepsy risk

Research Applications and Tools

Recombinant Brp44l is utilized in:

  • Biochemical Assays: Studying pyruvate transport kinetics and drug interactions (e.g., TZDs) .

  • Gene Knockout Models: Generating MPC1-deficient mice to model human MPYCD .

Key Antibodies and Reagents:

AntibodyTargetApplicationsReactivity
PA5-60929 (Thermo Fisher)BRP44L (MPC1)WB, IHC, IFMouse, Rat, Human
20049-1-AP (Proteintech)MPC2WB, IHC, IFMouse Brain Tissue

Emerging Research Findings

  • TZD Binding: The MPC complex is a direct target of TZDs, which enhance pyruvate transport and improve metabolic outcomes in insulin-resistant models .

  • Neurological Dysregulation: Deficiency in MPC1 reduces mitochondrial ATP, disrupts calcium homeostasis, and increases neuronal excitability .

  • Therapeutic Potential: Restoring MPC function could mitigate lactic acidosis and metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mpc1; Brp44l; Mitochondrial pyruvate carrier 1; Brain protein 44-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-109
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mpc1
Target Protein Sequence
AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA
Uniprot No.

Target Background

Function
Mediates the uptake of pyruvate into mitochondria.
Gene References Into Functions
  1. The MPC1 knockout inhibits mitochondrial pyruvate uptake and oxidative phosphorylation, leading to metabolic reprogramming towards aerobic Warburg glycolysis with reduced ATP production capability. PMID: 28624784
  2. Heterozygous MPC1 KO weakens fertility and influences glucose and fatty acid metabolism, as well as bodyweight in mice. PMID: 27835892
  3. This study suggests that inhibiting MPC1 activity can enhance fatty acid oxidation, providing sufficient energy to the body. PMID: 29175325
  4. Our research indicates that MPC1 and MPC2 expressions hold prognostic value in prostate cancers, with positive expression of MPC1 or MPC2 being a predictor of favorable outcomes. PMID: 27852261
  5. Results demonstrate that Mpc1 is essential for mammalian embryonic development and efficient pyruvate metabolism. PMID: 27215380
  6. This resulted in embryonic lethality around E13.5. Mouse embryonic fibroblasts (MEFs) derived from mutant mice exhibited impaired pyruvate-driven respiration and altered metabolic profiles. Both defects could be restored by re-expressing MPC1. PMID: 27176894
  7. Oxidative glutaminolysis supports the TCA cycle in mouse cells lacking MPC1/2. PMID: 25458843

Show More

Hide All

Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Brp44l and what is its relationship to MPC1?

Brp44l (Brain protein 44-like) is the alternative name for the protein now known as Mitochondrial Pyruvate Carrier 1 (MPC1). It functions as an essential component of the mitochondrial pyruvate carrier complex, partnering with MPC2 (previously known as Brain protein 44 or BRP44) to form a functional heterodimer that transports pyruvate across the inner mitochondrial membrane. This transport is critical for linking cytosolic glycolysis to mitochondrial oxidative phosphorylation and other metabolic pathways. The molecular identification and characterization of these proteins were achieved in 2012, resolving decades of uncertainty about the nature of mitochondrial pyruvate transport .

What are the molecular characteristics of mouse Brp44l/MPC1?

Mouse Brp44l/MPC1 is a relatively small protein with a calculated molecular weight of approximately 14 kDa, although it typically appears at 18-20 kDa on Western blots due to post-translational modifications. The protein is encoded by the MPC1 gene, which is located on chromosome 12 in mice. Brp44l/MPC1 contains transmembrane domains that anchor it in the inner mitochondrial membrane, where it forms a functional complex with MPC2. The protein complex creates a specific channel structure that allows for the selective transport of pyruvate molecules. Functionally, both MPC1 and MPC2 are required for the complex to properly transport pyruvate, as neither protein alone is sufficient for transport activity .

How is Brp44l/MPC1 expression detected in research settings?

Brp44l/MPC1 expression can be detected using various techniques:

  • Western Blot (WB): Using specific antibodies at dilutions of 1:500-1:2000. Typical positive detection has been demonstrated in HEK-293T cells, mouse brain tissue, and various cancer cell lines .

  • Immunofluorescence (IF): Can be performed at dilutions of 1:50-1:500, with positive detection demonstrated in cell lines such as HepG2 .

  • Immunohistochemistry (IHC): For tissue samples, fixed with 10% neutral formalin and embedded in paraffin. Using anti-BRP44L antibody (e.g., ab74871, dilution 1:50), followed by horseradish peroxidase-tagged secondary antibody and diaminobenzidine staining. Relative protein expression can be quantified using imaging software .

The choice of detection method depends on the specific research question, with Western blotting being most common for quantitative analysis, while immunofluorescence and immunohistochemistry provide spatial information about protein localization within cells or tissues.

What methodological approaches are most effective for generating Brp44l/MPC1 knockout mouse models?

The CRISPR/Cas9 system has proven to be the most efficient approach for generating Brp44l/MPC1 knockout mouse models. When designing such experiments, researchers should consider:

  • Guide RNA Design: Targeting the first exon has been successful in creating functional knockouts. Multiple guide RNAs should be designed and tested for efficiency.

  • Off-Target Analysis: Comprehensive screening for potential off-target effects is essential. PCR of F0 mice tail DNA with specific primers covering potential off-target sites should be performed. Research has identified that off-target mutations can occur at variable rates depending on the guide RNA used .

  • Breeding Strategy: Complete homozygous MPC1 knockout appears to result in infertility, making it impossible to maintain homozygous knockout lines. Therefore, heterozygous breeding is necessary for maintaining the line .

  • Verification of Knockout: Molecular verification through genotyping and functional assessment of MPC1 activity is crucial to confirm the knockout status.

The table below summarizes breeding outcomes observed in MPC1 knockout studies:

MaleFemaleMating PairsPregnancy RateTotal PupsHeterozygotesHomozygotes
MPC1+/−MPC1+/−1573% (11/15)7327 (37%)5 (7%)
WTMPC1−/−50% (0/5)000
MPC1−/−WT40% (0/4)000
MPC1−/−MPC1−/−40% (0/4)000

This data highlights the fertility challenges associated with MPC1 knockout models .

How does Brp44l/MPC1 deficiency influence metabolic phenotypes in mouse models?

Brp44l/MPC1 deficiency leads to significant metabolic alterations in mouse models:

  • Body Weight Regulation: Female heterozygous MPC1 knockout mice show significantly higher body weight compared to wild-type counterparts, suggesting a gender-specific role in metabolism regulation .

  • Glucose Metabolism: MPC1 deficiency appears to alter glucose utilization pathways. With reduced pyruvate entry into mitochondria, cells may upregulate glycolysis and lactate production as compensatory mechanisms.

  • Fatty Acid Metabolism: Altered pyruvate transport affects the TCA cycle and consequently influences fatty acid metabolism. Female heterozygous MPC1 KO mice show evidence of increased de novo lipogenesis enzyme activities, contradicting the bodyweight gain phenotype and suggesting complex metabolic adaptations .

  • Reproductive Function: Both male and female homozygous MPC1 knockout mice demonstrate infertility, indicating that pyruvate metabolism plays a critical role in reproductive function. Heterozygous knockouts also show reduced fertility compared to wild-type animals .

  • Mitochondrial Function: Impaired pyruvate transport due to MPC1 deficiency likely leads to mitochondrial dysfunction, affecting energy production and cellular homeostasis across multiple tissues.

These metabolic phenotypes highlight the central role of Brp44l/MPC1 in integrating glycolysis with mitochondrial energy production and biosynthetic pathways.

What is the role of Brp44l/MPC1 in cancer metabolism and how can this be experimentally investigated?

Brp44l/MPC1 plays a significant role in cancer metabolism, making it an important target for oncology research:

  • Expression Patterns: Depletion or extremely low levels of MPC1 protein are common features across multiple malignant cancer types and correlate with poorer prognosis. This suggests that MPC1 may function as a tumor suppressor .

  • Metabolic Reprogramming: Cancer cells often exhibit the Warburg effect, characterized by increased glycolysis and reduced mitochondrial oxidative phosphorylation even in the presence of oxygen. Reduced MPC1 expression may contribute to this phenotype by limiting pyruvate entry into mitochondria.

  • Experimental Approaches:

    • Expression Analysis: Immunohistochemistry and Western blotting can be used to assess MPC1 expression levels in tumor versus normal tissue samples .

    • Functional Studies: Overexpression or knockdown of MPC1 in cancer cell lines can reveal its impact on cellular metabolism, proliferation, and invasiveness.

    • Metabolic Flux Analysis: Using isotope-labeled glucose or pyruvate to track metabolic fate in cells with varying MPC1 expression.

    • In vivo Models: Xenograft studies using cancer cells with manipulated MPC1 expression can demonstrate its impact on tumor growth and metastasis.

  • Therapeutic Implications: Modulators of MPC activity (activators or inhibitors) might have potential as anticancer agents, depending on the cancer type and metabolic context.

Studies in hepatocellular carcinoma have shown that MPC expression can serve as a biomarker for recurrence and prognosis, suggesting similar applications may exist for other cancer types .

What are the optimal conditions for producing and purifying recombinant mouse Brp44l/MPC1 protein?

Producing functional recombinant Brp44l/MPC1 presents significant challenges due to its membrane-bound nature and requirement for partnering with MPC2 for proper function. The following methodological approach is recommended:

  • Expression System Selection:

    • Bacterial Systems: Not optimal for membrane proteins like MPC1 due to lack of proper post-translational modifications and folding machinery.

    • Insect Cell Systems: Sf9 or High Five cells offer better folding and post-translational modifications for membrane proteins.

    • Mammalian Expression Systems: HEK293 or CHO cells provide the most native-like environment but with lower yield.

  • Co-expression Strategy: Co-expressing MPC1 with MPC2 is crucial for proper folding and stability. Dual expression vectors or co-transfection approaches should be employed.

  • Purification Approach:

    • Mild detergents (DDM, LMNG) should be used for membrane protein extraction.

    • Affinity tags (His, FLAG, etc.) can facilitate purification, but their position should be carefully considered to avoid interfering with protein function.

    • Size exclusion chromatography is recommended as a final purification step to ensure homogeneity.

  • Functional Validation: Pyruvate transport assays using reconstituted proteoliposomes or membrane vesicles should be performed to confirm the functionality of the purified complex.

  • Storage Conditions: Purified protein should be stored in the presence of appropriate detergents or reconstituted into nanodiscs or liposomes for improved stability.

This methodological approach balances the need for protein purity with maintaining the functional integrity of the MPC complex.

What considerations are important when designing antibodies against mouse Brp44l/MPC1?

Designing effective antibodies against mouse Brp44l/MPC1 requires careful consideration of several factors:

  • Epitope Selection:

    • Target unique, accessible regions that are not embedded in the membrane.

    • Avoid highly conserved regions if species specificity is required.

    • Consider using peptide immunogens representing hydrophilic domains of the protein.

  • Cross-reactivity Considerations:

    • Commercially available antibodies have shown reactivity with human, mouse, and rat MPC1 .

    • When developing new antibodies, testing for cross-reactivity with related proteins or MPC1 from different species is essential.

  • Validation Methods:

    • Western blot using tissues known to express high levels of MPC1, such as brain tissue.

    • Immunoprecipitation followed by mass spectrometry to confirm specificity.

    • Testing in MPC1 knockout and wild-type tissues to confirm specificity.

    • Immunofluorescence to verify expected mitochondrial localization.

  • Application-specific Optimization:

    • For Western blotting, recommended dilutions range from 1:500 to 1:2000.

    • For immunofluorescence, recommended dilutions range from 1:50 to 1:500 .

    • Buffer conditions may need to be optimized depending on the specific application.

  • Storage and Handling:

    • Most antibodies are stored in PBS with 0.02% sodium azide and 50% glycerol at pH 7.3.

    • Storage at -20°C is typically recommended for long-term stability .

Proper antibody design and validation are critical for obtaining reliable results in Brp44l/MPC1 research.

How can mouse models of Brp44l/MPC1 deficiency inform our understanding of human metabolic diseases?

Mouse models of Brp44l/MPC1 deficiency provide valuable insights into human metabolic diseases through several mechanisms:

  • Metabolic Syndrome and Obesity: The observation that female heterozygous MPC1 knockout mice develop increased body weight suggests that MPC1 plays a role in regulating energy homeostasis and lipid metabolism. This may inform our understanding of human obesity and metabolic syndrome, particularly regarding gender-specific differences .

  • Mitochondrial Disorders: Since MPC1 is essential for mitochondrial pyruvate metabolism, mouse models can help elucidate the role of pyruvate transport defects in human mitochondrial diseases. Metabolic characterization of these models can reveal compensatory pathways that might be targeted therapeutically.

  • Cancer Metabolism: The finding that MPC1 expression is frequently reduced in human cancers parallels observations in mouse models. These models can be used to investigate how altered pyruvate metabolism contributes to cancer development and progression .

  • Reproductive Disorders: The infertility observed in homozygous MPC1 knockout mice suggests a critical role for pyruvate metabolism in reproduction. This may have implications for understanding certain forms of human infertility .

  • Translational Applications:

    • Drug screening using MPC1-deficient mice to identify compounds that normalize metabolic abnormalities.

    • Testing whether MPC activation could remediate metabolic disorders.

    • Investigating tissue-specific effects of MPC1 deficiency using conditional knockout models.

By correlating metabolic phenotypes in mouse models with human disease presentations, researchers can identify novel therapeutic targets and develop more effective interventions for metabolic disorders.

What techniques can be used to monitor MPC complex activity and pyruvate transport in experimental systems?

Several sophisticated techniques can be employed to monitor MPC complex activity and pyruvate transport:

  • Radioisotope-Based Transport Assays:

    • Using 14C-labeled pyruvate to measure transport into isolated mitochondria.

    • Allows for quantitative measurement of transport kinetics (Km, Vmax).

    • Can be combined with specific inhibitors to confirm MPC-dependent transport.

  • Membrane Potential-Sensitive Fluorescent Probes:

    • Since pyruvate transport is dependent on the proton gradient, fluorescent probes like TMRM or JC-1 can indirectly monitor conditions affecting transport.

    • Provides real-time monitoring capabilities in intact cells.

  • Seahorse XF Analyzer Measurements:

    • Measures oxygen consumption rate (OCR) as an indicator of mitochondrial function.

    • By supplying pyruvate and comparing OCR in MPC1-deficient versus normal cells, MPC function can be assessed.

    • Allows for real-time monitoring in intact cells under various conditions.

  • Metabolic Flux Analysis:

    • Using 13C-labeled glucose or pyruvate followed by mass spectrometry to track metabolite fate.

    • Reveals how pyruvate is distributed between different metabolic pathways in MPC-deficient versus normal conditions.

    • Provides comprehensive view of cellular metabolism beyond simple transport.

  • Reconstituted Systems:

    • Purified MPC complex reconstituted into proteoliposomes.

    • Allows for detailed biophysical characterization of transport properties.

    • Enables structure-function studies using site-directed mutagenesis.

These techniques provide complementary information about MPC function at different levels of biological organization, from purified proteins to intact organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.