Recombinant Mouse Brain protein 44 (Brp44)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Brp44 is encoded by the MPC2 gene (Gene ID: 25874) and functions as part of a heterodimeric complex with MPC1 to transport pyruvate into mitochondria . Key structural and biochemical properties include:

PropertyDetail
Molecular Weight14 kDa (calculated); 18–20 kDa (observed via SDS-PAGE)
Protein DomainsThree helical domains (residues 41–61, 73–90, and 96–115)
Subcellular LocalizationInner mitochondrial membrane
Post-Translational ModificationsPredicted phosphorylation sites at Ser-50 and Ser-59

Functional Role in Metabolism

Brp44 is essential for mitochondrial pyruvate import, linking cytosolic glycolysis to the tricarboxylic acid (TCA) cycle . Key findings include:

  • Energy Production: Knockout of MPC2 in mice causes embryonic lethality due to disrupted pyruvate oxidation .

  • Metabolic Flexibility: MPC1/MPC2 heterodimer loss reduces mitochondrial respiration and increases lactate production .

  • Drug Targets: Brp44 binds thiazolidinedione (TZD) insulin sensitizers, suggesting a role in metabolic disease therapeutics .

Research Applications

Recombinant Brp44 and related antibodies are widely used in biochemical studies:

Antibody Performance Data

ApplicationClone/ProductDilutionReactivities
Western BlottingMABS1914 (Millipore)1 μg/mL–4 μg/mLHuman, Mouse
Immunoprecipitation20049-1-AP (Proteintech)1:1,000Human, Mouse, Rat
Immunofluorescenceab236584 (Abcam)1:50–1:500Human, Mouse

Key Research Findings

  • Neurological Disorders: MPC2 knockdown in neurons exacerbates ischemic injury by impairing mitochondrial energy production .

  • Cancer Metabolism: Reduced Brp44 expression in bladder cancer correlates with enhanced glycolytic activity and chemoresistance .

  • Bone Homeostasis: MPC2 blockade decreases osteoclastogenesis by altering mitochondrial ATP synthesis .

Clinical Relevance

Mutations in MPC2 are linked to mitochondrial pyruvate carrier deficiency, characterized by:

  • Early-onset neurological deficits (hypotonia, developmental delay) .

  • Metabolic acidosis with elevated lactate/pyruvate ratios .

  • Cardiomegaly and facial dysmorphia .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Mpc2; Brp44; Mitochondrial pyruvate carrier 2; Brain protein 44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mpc2
Target Protein Sequence
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQE LKSKGIQ
Uniprot No.

Target Background

Function
Mediates the uptake of pyruvate into mitochondria.
Gene References Into Functions
  1. Tolylfluanid's inhibition of pyruvate metabolism requires MPC2. PMID: 29126303
  2. The interaction between TZDs and MPC2 remains unaffected by the absence of the N-terminal 16 amino acids. PMID: 28597936
  3. Increased MPC2 acetylation is observed in diabetic heart mitochondria. This suggests that deficient pyruvate transport activity, partially mediated by MPC2 acetylation, contributes to metabolic inflexibility in the diabetic heart. PMID: 28154187
  4. Oxidative glutaminolysis supports the TCA cycle in mouse cells lacking MPC1/2. PMID: 25458843
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is BRP44/MPC2 and what is its primary function?

BRP44, officially known as Mitochondrial Pyruvate Carrier 2 (MPC2), is a protein that belongs to the UPF0041 family. Its primary function is mediating the uptake of pyruvate into mitochondria, making it essential for cellular energy metabolism . The protein forms part of a complex that serves as a gatekeeper for pyruvate entry into the mitochondrial matrix, where it can enter the TCA cycle for ATP production. Understanding this protein's function is crucial for research into metabolic disorders and mitochondrial function.

When studying this protein, researchers should note that while its calculated molecular weight is approximately 14 kDa, it typically appears at 18-20 kDa on Western blots due to post-translational modifications and the behavior of membrane proteins during electrophoresis .

What are the key structural and molecular characteristics of mouse BRP44/MPC2?

Mouse BRP44/MPC2 is a relatively small protein with a calculated molecular weight of 14 kDa, though it migrates at 18-20 kDa on SDS-PAGE gels . The gene encoding MPC2 (Gene ID: 25874) has been well-characterized, with information available in genomic databases. The protein is primarily located in the mitochondrial membrane, consistent with its role in pyruvate transport.

For experimental investigations, it's important to understand that BRP44/MPC2 functions as part of a heterodimeric complex with MPC1 (also known as BRP44L). This complex formation is essential for its functional activity in transporting pyruvate across the inner mitochondrial membrane. The protein contains conserved domains characteristic of the UPF0041 family, which are critical for its functional interactions .

What are the optimal antibody selection criteria and application parameters for detecting BRP44/MPC2?

When selecting antibodies for BRP44/MPC2 detection, researchers should consider reactivity, application compatibility, and validation status. Based on available data, several antibodies have been validated for multiple applications with specific recommended dilutions:

ApplicationRecommended DilutionValidated SystemsReference
Western Blot (WB)1:500-1:2000HEK-293T cells, mouse brain tissue, LNCaP cells, PC-3 cells
Immunofluorescence (IF)/ICC1:50-1:500HepG2 cells
Immunohistochemistry (IHC-P)1:100Human liver cancer tissue, human gastric cancer tissue
Immunoprecipitation (IP)Application-specificHuman, mouse samples

For optimal results, researchers should consider:

  • Validating antibody specificity using appropriate controls

  • Sample-dependent optimization of dilutions

  • Selection between polyclonal (broader epitope recognition) and monoclonal (higher specificity) antibodies depending on the experimental question

  • Confirming species reactivity (most validated antibodies react with human, mouse, and rat samples)

What experimental conditions are critical for successful Western blot detection of BRP44/MPC2?

Successful Western blot detection of BRP44/MPC2 requires specific attention to several experimental conditions:

  • Sample preparation: Due to BRP44/MPC2's mitochondrial localization, researchers should ensure efficient extraction of membrane proteins using appropriate lysis buffers containing mild detergents.

  • Gel selection: Use 12-15% polyacrylamide gels to properly resolve this low molecular weight protein.

  • Transfer conditions: Optimize transfer parameters for small proteins, generally using lower current/voltage for longer duration to prevent loss of small proteins during transfer.

  • Blocking and antibody incubation:

    • Primary antibody dilutions typically range from 1:500-1:2000 for BRP44/MPC2 detection

    • Secondary antibody selection should match the host species of the primary antibody, with recommended dilutions around 1:50000

  • Expected band visualization: Be aware that while the calculated molecular weight is 14 kDa, the observed molecular weight is typically 18-20 kDa on Western blots

  • Validated positive controls: HEK-293T cells, mouse brain tissue, LNCaP cells, and PC-3 cells have been confirmed to express detectable levels of BRP44/MPC2

For troubleshooting weak or absent signals, consider mitochondrial enrichment protocols to concentrate the target protein prior to Western blotting.

How can researchers effectively design experiments to investigate BRP44/MPC2's role in mitochondrial pyruvate transport?

To investigate BRP44/MPC2's role in mitochondrial pyruvate transport, researchers should implement a multi-faceted experimental design:

  • Genetic manipulation approaches:

    • CRISPR/Cas9 knockout or knockdown of MPC2 in cellular models

    • Generation of conditional tissue-specific knockout mouse models

    • Rescue experiments with wild-type and mutant constructs

  • Functional transport assays:

    • Measure pyruvate uptake using radiolabeled substrates in isolated mitochondria

    • Oxygen consumption rate (OCR) measurements using Seahorse technology to assess mitochondrial function

    • Metabolic flux analysis to trace carbon movement through pyruvate-dependent pathways

  • Interaction studies:

    • Co-immunoprecipitation to confirm BRP44/MPC2 interaction with MPC1 (BRP44L)

    • Blue native PAGE to analyze intact complexes

    • Proximity labeling approaches to identify novel interaction partners

  • Physiological impact assessment:

    • Measure cellular bioenergetics parameters

    • Analyze mitochondrial membrane potential

    • Assess cellular responses to metabolic stress conditions

Remember that BRP44/MPC2 functions as part of a heterodimeric complex with MPC1, so experimental design should account for this interaction. Deficiency in either component can lead to dysfunction in pyruvate transport, affecting downstream metabolic processes.

What are the key considerations when using recombinant BRP44/MPC2 in structural and functional studies?

When using recombinant BRP44/MPC2 in structural and functional studies, researchers should address several critical considerations:

  • Expression system selection:

    • Prokaryotic systems (E. coli) may lack proper post-translational modifications

    • Eukaryotic systems (insect cells, mammalian cells) provide better folding and modification but have lower yields

    • For membrane proteins like BRP44/MPC2, specialized strains optimized for membrane protein expression are recommended

  • Protein solubilization and purification:

    • Careful selection of detergents is crucial for maintaining protein structure and function

    • Gradient purification to ensure homogeneity

    • Consider nanodiscs or liposomes for functional reconstitution

  • Functional validation:

    • In vitro transport assays using proteoliposomes

    • Binding studies with substrate analogs

    • Confirmation of complex formation with MPC1

  • Structural considerations:

    • Cryo-EM may be preferable to crystallography for membrane protein complexes

    • Proper selection of tags that don't interfere with function

    • Site-directed mutagenesis to identify critical residues for function

  • Storage and stability:

    • Optimize buffer conditions for long-term stability

    • Consider the addition of stabilizing agents

When designing recombinant constructs, researchers should note that while the calculated molecular weight of BRP44/MPC2 is 14 kDa, post-translational modifications may affect the apparent molecular weight (typically observed at 18-20 kDa) . Additionally, functional studies should account for the requirement of complex formation with MPC1 for proper transport activity.

How does BRP44/MPC2 dysfunction contribute to pathological conditions, and what experimental approaches can assess this relationship?

BRP44/MPC2 dysfunction has been implicated in several pathological conditions due to its critical role in cellular metabolism. Researchers investigating these relationships should consider the following approaches:

  • Metabolic disorders:

    • Analyze pyruvate metabolism in patient-derived cells

    • Measure mitochondrial function using respirometry

    • Assess metabolic flexibility through substrate utilization studies

    • Examine compensatory mechanisms that may activate upon MPC dysfunction

  • Cancer metabolism:

    • Evaluate the Warburg effect in relation to MPC2 expression levels

    • Investigate cancer cell sensitivity to MPC inhibitors

    • Analyze tissue microarrays for MPC2 expression across cancer types

    • As observed in human liver and gastric cancer tissues, MPC2 expression can be assessed through immunohistochemistry

  • Neurodegenerative conditions:

    • Assess pyruvate utilization in neuronal models

    • Investigate mitochondrial energy production in brain-specific MPC2 knockout models

    • Evaluate oxidative stress markers and mitochondrial dynamics

  • Experimental design considerations:

    • Use both genetic (knockout/knockdown) and pharmacological (inhibitors) approaches

    • Include tissue-specific analyses, as MPC2 function may vary between tissues

    • Implement metabolomics to capture broader metabolic consequences

    • Consider compensatory pathways that may mask phenotypes

Mitochondrial pyruvate carrier deficiency (MPYCD) is directly linked to mutations in MPC1 (BRP44L) , and by extension, alterations in the MPC1-MPC2 complex function. This emphasizes the importance of studying both components of the complex in disease contexts.

What strategies can be employed to study the therapeutic potential of targeting BRP44/MPC2 in metabolic diseases?

To investigate the therapeutic potential of targeting BRP44/MPC2 in metabolic diseases, researchers should employ a comprehensive experimental strategy:

  • Target validation approaches:

    • Utilize conditional tissue-specific knockouts to assess the impact of MPC2 modulation in affected tissues

    • Implement inducible systems to determine temporal requirements for intervention

    • Evaluate the effects of known MPC inhibitors on metabolic parameters in disease models

    • Consider the heterodimeric nature of the MPC complex when designing targeting strategies

  • Small molecule development and screening:

    • Design high-throughput screens for MPC2 activity modulators

    • Develop assays for measuring pyruvate transport in reconstituted systems

    • Validate hits in cellular models before progressing to animal studies

    • Characterize both activators and inhibitors to provide experimental flexibility

  • Therapeutic delivery considerations:

    • Develop mitochondrial-targeted delivery systems for improved specificity

    • Evaluate tissue-specific distribution of potential therapeutics

    • Consider blood-brain barrier permeability for neurological applications

  • Outcome measurements:

    • Monitor changes in pyruvate-dependent metabolic pathways

    • Assess improvements in mitochondrial function

    • Evaluate systemic metabolic parameters

    • Quantify changes in disease-specific biomarkers

  • Combination approaches:

    • Test MPC2-targeting agents in combination with existing metabolic disease therapies

    • Investigate synergistic effects with other mitochondrial function modulators

For researchers investigating MPC2's therapeutic potential, it's critical to consider both beneficial and potentially detrimental effects of modulating pyruvate transport, as this represents a fundamental metabolic node with widespread consequences for cellular function.

How can recent advances in proteomics and metabolomics be applied to study BRP44/MPC2 function and regulation?

Advanced proteomics and metabolomics techniques offer powerful approaches to elucidate BRP44/MPC2 function and regulation:

  • Quantitative proteomics applications:

    • Thermal proteome profiling to identify direct binding partners and effectors

    • SILAC or TMT labeling to quantify changes in the mitochondrial proteome following MPC2 manipulation

    • Phosphoproteomics to identify regulatory post-translational modifications

    • Proximity labeling (BioID/APEX) to map the spatial proteome surrounding MPC2

    • Cross-linking mass spectrometry to determine complex architecture

  • Metabolomics approaches:

    • Stable isotope tracing to map pyruvate flux through various metabolic pathways

    • Untargeted metabolomics to identify novel metabolic consequences of MPC2 modulation

    • In vivo metabolic imaging to visualize dynamic changes in pyruvate utilization

    • Integration of metabolomics with transcriptomics to identify compensatory mechanisms

  • Multi-omics integration strategies:

    • Correlation of proteomic changes with metabolic alterations

    • Network analysis to identify regulatory hubs

    • Pathway enrichment to contextualize findings

  • Time-resolved analyses:

    • Pulse-chase experiments to determine protein turnover rates

    • Temporal metabolomics to capture dynamic responses

    • Circadian profiling to identify time-dependent regulation

These advanced techniques allow researchers to move beyond simple expression analysis and develop comprehensive models of how BRP44/MPC2 functions within the broader cellular metabolic network, potentially identifying novel regulatory mechanisms and therapeutic targets.

What are the emerging technologies that might revolutionize our understanding of BRP44/MPC2 biology?

Several cutting-edge technologies are poised to transform our understanding of BRP44/MPC2 biology:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize MPC2 distribution and dynamics within mitochondria

    • Live-cell imaging with genetically encoded sensors to monitor pyruvate flux in real-time

    • Correlative light and electron microscopy to link functional data with ultrastructural information

    • Expansion microscopy to reveal previously undetectable protein interactions

  • CRISPR-based technologies:

    • CRISPRi/CRISPRa for temporal and graded control of MPC2 expression

    • CRISPR screening to identify genetic modifiers of MPC2 function

    • Base editing for precise introduction of disease-relevant mutations

    • CRISPR-mediated tagging for endogenous protein tracking

  • Single-cell approaches:

    • Single-cell proteomics to reveal cell-to-cell variability in MPC complex composition

    • Single-cell metabolomics to identify metabolic heterogeneity in response to MPC2 modulation

    • Spatial transcriptomics to map expression patterns in complex tissues

  • Structural biology advances:

    • Cryo-electron tomography to visualize MPC2 in its native mitochondrial environment

    • AlphaFold/RoseTTAFold predictions to guide structure-function studies

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic structural changes

  • Organoid and tissue engineering approaches:

    • Patient-derived organoids to study MPC2 function in disease-relevant contexts

    • Engineered tissues with controlled metabolic environments

    • Microfluidic organ-on-chip systems to examine tissue-specific metabolic requirements

These emerging technologies will enable researchers to address previously intractable questions about MPC2 biology, including its dynamic regulation, tissue-specific functions, and roles in complex disease states. Integration of these approaches will likely yield a systems-level understanding of how this small but critical protein influences cellular metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.