Recombinant Mouse Brain protein I3 (Bri3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bri3; Brain protein I3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Bri3
Target Protein Sequence
MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT
Uniprot No.

Target Background

Function
Brain protein I3 (Bri3) participates in tumor necrosis factor-alpha (TNF)-induced cell death and may be a target of Wnt/β-catenin signaling in the liver.
Gene References Into Functions
  1. Bri3 plays a significant role in TNF-induced cell death, potentially through lysosomal localization and function. PMID: 14592447
Database Links
Protein Families
BRI3 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Tissue Specificity
High expression in cerebral cortex, and in cerebellar cortex.

Q&A

What is Brain protein I3 (BRI3) and what are its key characteristics?

Brain protein I3 (BRI3) is a protein-coding gene that expresses a membrane-associated protein found predominantly in neural tissues. In mice, BRI3 has a molecular weight of approximately 13.6 kDa and is classified within the BRI3 protein family . The protein was initially characterized as a TNF-α upregulated protein in brain endothelial cells, suggesting a potential role in inflammatory responses . BRI3 is conserved across multiple species including human, mouse, rat, and domestic ferret, indicating its evolutionary significance . The protein has several alternative names in the literature including pRGR2, which researchers should be aware of when conducting literature searches .

What detection methods are available for mouse BRI3 in experimental settings?

Several methodological approaches can be employed for detecting mouse BRI3 in research settings:

  • Western Blotting (WB): Polyclonal antibodies against BRI3 are available and validated for WB applications. The recommended dilution range is typically 1:500-1:1000 for optimal detection . This technique allows for semi-quantitative analysis of BRI3 expression in tissue homogenates or cell lysates.

  • ELISA: Quantitative detection of mouse BRI3 is possible using species-specific ELISA kits with a typical detection range of 0.156-10 ng/ml . This method is particularly useful for precise quantification in complex biological samples.

  • Genetic Tagging: CRISPR/Cas9-mediated epitope tagging (such as HA-tag) of endogenous BRI3 can facilitate detection in pull-down assays and co-immunoprecipitation experiments, as demonstrated with its binding partner BRI3BP .
    For optimal results, researchers should use appropriate positive controls (such as mouse brain tissue lysates) and validate antibody specificity before conducting large-scale experiments .

What is the subcellular localization of BRI3 and how can it be visualized?

BRI3 is predominantly a membrane-associated protein, with particular enrichment in the recycling endosomal compartment, which plays a critical role in its function . To investigate the subcellular localization of BRI3, researchers can employ the following methodologies:

  • Subcellular Fractionation: Differential centrifugation techniques can separate membrane fractions containing BRI3 from cytosolic proteins.

  • Confocal Microscopy: Immunofluorescence using validated anti-BRI3 antibodies can visualize the protein's distribution in fixed cells. Co-staining with markers for different cellular compartments (e.g., plasma membrane, endosomal markers) can provide precise localization information.

  • Live-Cell Imaging: For dynamic studies, researchers can generate fusion constructs of BRI3 with fluorescent proteins (e.g., GFP) to track its movement within living cells, though care must be taken to ensure the tag doesn't interfere with protein function.
    When investigating BRI3 localization, researchers should be aware that its distribution may be altered in response to cellular stimuli or in disease states, necessitating comparative analyses under different experimental conditions .

What are the known protein interactions of mouse BRI3?

Mouse BRI3 engages in several protein-protein interactions that are critical to understanding its cellular functions:

  • BRI3BP (Brain I3 Binding Protein): BRI3 was initially identified through its interaction with BRI3BP, which has since been characterized as a binding partner for Ras proteins .

  • Signaling Pathways: Through its binding partner BRI3BP, BRI3 is indirectly connected to the Ras signaling pathway, particularly the K-Ras4B isoform. This suggests potential roles in signal transduction mechanisms relevant to cell proliferation and differentiation .
    Research techniques to study these interactions include:

  • Pull-down assays with tagged proteins

  • Co-immunoprecipitation of endogenous proteins

  • Yeast two-hybrid screening for novel interaction partners

  • Proximity ligation assays for in situ detection of protein complexes
    Understanding these interactions provides insight into the potential functional roles of BRI3 in both normal physiology and pathological states .

How does BRI3 contribute to K-Ras signaling pathways and what experimental approaches can be used to study this relationship?

BRI3's relationship with K-Ras signaling is primarily mediated through its binding partner BRI3BP. Research has demonstrated that BRI3BP preferentially interacts with K-Ras4B (approximately 7-fold selectivity compared to other Ras isoforms) and regulates its plasma membrane localization and subsequent signaling activity . This interaction is dependent on the farnesylation of Ras, suggesting that BRI3BP functions as a prenyl recognition protein within the recycling endosomal compartment .
To investigate this relationship, researchers can employ the following experimental approaches:

  • Genetic Manipulation: CRISPR/Cas9-mediated knockout or knockdown of BRI3 to assess indirect effects on K-Ras localization and signaling.

  • Biochemical Interaction Studies:

    • GST pull-down assays with wild-type and mutant K-Ras4B (including CAAX box mutations that prevent prenylation)

    • Co-immunoprecipitation of endogenous proteins

    • Domain mapping using truncated constructs to identify critical interaction regions

  • Functional Assays:

    • Ras activation assays (e.g., RBD pull-down)

    • Downstream signaling analysis (phosphorylation of ERK, AKT)

    • Transformation assays in NIH3T3 cells to assess oncogenic potential

  • Advanced Imaging:

    • FRET/BRET analysis to detect protein proximity in living cells

    • High-resolution microscopy to track co-localization in specific cellular compartments
      These approaches can help delineate the molecular mechanisms by which BRI3, through BRI3BP, contributes to Ras-mediated signaling cascades relevant to both normal cellular functions and oncogenic transformation .

What are the challenges in producing and working with recombinant mouse BRI3 protein, and how can these be addressed?

Working with recombinant mouse BRI3 presents several technical challenges that researchers should anticipate:

  • Membrane Protein Expression: As a membrane-associated protein, BRI3 can be difficult to express in soluble form. Researchers should consider:

    • Using specialized expression systems designed for membrane proteins

    • Creating fusion constructs with solubility-enhancing tags (e.g., MBP, SUMO)

    • Employing detergent-based extraction methods optimized for membrane proteins

  • Conformational Integrity: Maintaining proper protein folding is critical for functional studies. Solutions include:

    • Expression in eukaryotic systems rather than bacterial systems

    • Inclusion of chaperones during expression

    • Optimization of purification conditions to preserve native structure

  • Post-translational Modifications: Mouse BRI3 may undergo important post-translational modifications in vivo. Researchers should:

    • Characterize the modification pattern in native tissues

    • Select expression systems capable of reproducing relevant modifications

    • Consider using mass spectrometry to verify modification status

  • Functional Validation: Commercial ELISA kits are optimized for detection of native samples rather than recombinant proteins, which may have different sequences or tertiary structures . Therefore:

    • Functional assays should be developed to confirm biological activity

    • Comparative studies between native and recombinant protein should be conducted

    • Multiple detection methods should be employed to ensure proper characterization

  • Stability Concerns: Purified recombinant BRI3 may have limited stability. Researchers should:

    • Test various buffer conditions to optimize stability

    • Consider flash-freezing aliquots to minimize freeze-thaw cycles

    • Develop rigorous quality control measures to verify integrity before experiments
      By addressing these challenges methodically, researchers can produce high-quality recombinant mouse BRI3 suitable for structural studies, antibody generation, and functional assays.

How can researchers effectively study the role of BRI3 in neurological disorders and cancer models?

Given the emerging role of BRI3 in signaling pathways relevant to both neurological function and cancer biology, researchers can employ several approaches to investigate its contribution to disease:
In Neurological Disorder Models:

  • Expression Analysis:

    • Quantitative comparison of BRI3 levels in affected vs. normal tissues using validated ELISA kits

    • Single-cell transcriptomics to identify cell-specific alterations in expression

    • Spatial transcriptomics to map regional changes in brain tissue

  • Genetic Approaches:

    • Conditional knockout mouse models with brain-region specific deletion

    • AAV-mediated overexpression or knockdown in specific neural circuits

    • Humanized mouse models carrying disease-relevant mutations

  • Functional Assessment:

    • Electrophysiological recordings to assess effects on neuronal activity

    • Behavioral assays to evaluate cognitive or motor deficits

    • Histopathological analysis to detect morphological changes
      In Cancer Models:

  • Signaling Pathway Analysis:

    • Assessment of how BRI3 and BRI3BP affect K-Ras-mediated transformation

    • Investigation of BRI3's role in recycling endosomal trafficking of oncoproteins

    • Evaluation of how BRI3 expression correlates with Ras mutation status

  • Transformation Assays:

    • Focus formation assays in NIH3T3 cells with modulated BRI3 expression

    • Soft agar colony formation to assess anchorage-independent growth

    • Xenograft models to evaluate in vivo tumor growth and metastasis

  • Therapeutic Targeting:

    • Development of inhibitors disrupting BRI3-BRI3BP or BRI3BP-Ras interactions

    • PROTAC approaches to selectively degrade BRI3 in cancer cells

    • Combination studies with existing Ras pathway inhibitors
      These approaches should be coupled with comprehensive molecular characterization using techniques like RNA-seq, proteomics, and phospho-proteomics to fully understand the downstream consequences of BRI3 modulation in disease contexts .

What are the optimal experimental conditions for studying BRI3 protein-protein interactions?

Investigating BRI3 protein-protein interactions, particularly with its binding partner BRI3BP and indirectly with Ras proteins, requires carefully optimized experimental conditions:

  • Cell and Tissue Selection:

    • Brain tissue lysates provide a physiologically relevant source of BRI3

    • HEK293 cells with CRISPR-modified endogenous tagged BRI3 offer a controlled system

    • Neural cell lines expressing detectable levels of BRI3 are preferable for interaction studies

  • Lysis and Buffer Conditions:

    Buffer ComponentRecommended RangePurpose
    Detergent0.5-1% NP-40 or Triton X-100Membrane disruption
    Salt150-300 mM NaClReduce non-specific binding
    pH7.2-7.5Maintain protein stability
    Protease inhibitorsComplete cocktailPrevent degradation
    Phosphatase inhibitorsComplete cocktailPreserve phosphorylation
  • Interaction Detection Methods:

    • Co-immunoprecipitation: Using anti-BRI3 antibodies at 1:500 dilution with optimized wash conditions

    • Pull-down assays: GST-tagged constructs of interaction partners (e.g., K-RasV12) with thorough controls

    • Proximity-based approaches: BioID or APEX2 fusion proteins for capturing transient interactions

    • Advanced biophysical methods: Surface plasmon resonance or microscale thermophoresis for quantitative binding parameters

  • Critical Controls:

    • CAAX box mutants (SAAX) of Ras proteins to confirm prenylation dependency

    • Palmitoylation-defective H-Ras mutants (C2S2) to assess lipid modification effects

    • Domain-specific mutants to map interaction interfaces

    • Competition assays with peptides to confirm specificity

  • Visualization Strategies:

    • Western blotting with optimized antibody dilutions (1:500-1:1000)

    • Fluorescent protein fusions for live-cell imaging of interactions

    • FRET pairs to detect proximity in intact cells
      By systematically optimizing these conditions, researchers can reliably detect and characterize the interactions of BRI3 with its binding partners, thereby gaining insight into its molecular functions and potential roles in disease mechanisms .

What are the emerging technologies for manipulating BRI3 expression and function in research models?

The study of BRI3 function has been enhanced by several cutting-edge technologies that allow precise manipulation of its expression and activity:

  • CRISPR/Cas9 Genome Editing:

    • Generation of knockout cell lines and animal models

    • Introduction of point mutations to study structure-function relationships

    • Epitope tagging of endogenous BRI3 for detection without overexpression artifacts

    • Base editing approaches for introducing specific codon changes without double-strand breaks

  • RNA-based Technologies:

    • siRNA and shRNA for transient or stable knockdown

    • CRISPR interference (CRISPRi) for transcriptional repression without altering DNA sequence

    • mRNA therapeutics for transient expression of wild-type or mutant BRI3

    • Antisense oligonucleotides for splice modulation to generate specific isoforms

  • Protein-level Manipulation:

    • Degrader technologies (PROTACs, dTAGs) for rapid and reversible protein depletion

    • Optogenetic tools to control BRI3 localization or interactions with light

    • Chemically-induced proximity systems to trigger protein-protein interactions

    • Nanobodies for acute inhibition of specific protein domains

  • Advanced Imaging:

    TechnologyApplication for BRI3 Research
    Super-resolution microscopyPrecise subcellular localization at nanometer scale
    CLEM (Correlative Light-Electron Microscopy)Combining fluorescence with ultrastructural detail
    Light-sheet microscopyWhole-tissue imaging with reduced phototoxicity
    Lattice light-sheet microscopyDynamic studies of BRI3 trafficking in living cells
  • Organoid and In Vivo Models:

    • Brain organoids for studying BRI3 function in 3D neural tissues

    • Patient-derived xenografts to evaluate BRI3 in human tumors

    • AAV-delivered expression or knockdown for region-specific manipulation in vivo

    • Conditional expression systems (Tet-On/Off, Cre-loxP) for temporal control
      These emerging technologies offer unprecedented precision in manipulating BRI3 expression and function, allowing researchers to address complex questions about its role in normal physiology and disease states with minimal confounding factors .

What are common pitfalls in BRI3 detection assays and how can they be addressed?

Researchers working with mouse BRI3 should be aware of several technical challenges that can affect experimental outcomes:

  • Antibody Specificity Issues:

    • Problem: Cross-reactivity with related proteins leading to false positive signals

    • Solution: Validate antibodies using positive controls (brain tissue lysates) and negative controls (BRI3 knockout samples)

    • Best Practice: Use multiple antibodies targeting different epitopes to confirm results

  • Detection Sensitivity Limitations:

    • Problem: Low endogenous expression levels in some tissues making detection difficult

    • Solution: Optimize protein extraction methods specifically for membrane proteins

    • Best Practice: Use enrichment strategies like immunoprecipitation before Western blotting

  • ELISA Quantification Challenges:

    • Problem: Matrix effects in complex biological samples affecting accuracy

    • Solution: Use the mid-range of the standard curve (0.156-10 ng/ml) for most reliable results

    • Best Practice: Prepare standard curves in the same matrix as the experimental samples

  • Recombinant Protein Recognition:

    • Problem: Commercial kits optimized for native proteins may poorly detect recombinant versions

    • Solution: Be aware that recombinant proteins may have different tertiary structures affecting epitope accessibility

    • Best Practice: Validate detection methods specifically for the recombinant protein being used

  • Sample Stability Concerns:

    • Problem: BRI3 degradation during sample handling affecting quantification

    • Solution: Maintain consistent sample preparation conditions and minimize freeze-thaw cycles

    • Best Practice: Store samples at -80°C with protease inhibitors and process all experimental samples simultaneously
      By anticipating these common pitfalls and implementing appropriate controls and optimization strategies, researchers can significantly improve the reliability and reproducibility of their BRI3 detection assays .

How should researchers design experiments to study the functional relationship between BRI3 and BRI3BP?

The functional relationship between BRI3 and BRI3BP represents an important research area, particularly given BRI3BP's role in K-Ras signaling. Designing robust experiments to study this relationship requires careful consideration:

  • Establishing Expression Systems:

    • Generate cell lines with tagged versions of both proteins (e.g., HA-BRI3BP, FLAG-BRI3)

    • Create CRISPR knockout lines for each protein to study dependency relationships

    • Develop inducible expression systems to control protein levels temporally

  • Interaction Analysis Framework:

    TechniquePurposeKey Controls
    Co-immunoprecipitationDetect physical associationIgG control, lysate input control
    Proximity ligation assayVisualize interactions in situAntibody specificity controls
    FRET/BRETMeasure interaction dynamicsDonor-only, acceptor-only controls
    Domain mappingIdentify critical regionsSystematic deletion constructs
  • Functional Readouts:

    • Assess membrane localization of both proteins using subcellular fractionation

    • Measure downstream signaling effects (Ras activation, ERK phosphorylation)

    • Evaluate cellular phenotypes (proliferation, migration, differentiation)

    • Perform rescue experiments to confirm specificity (e.g., BRI3BP knockout rescued by wild-type but not mutant BRI3BP)

  • Advanced Approaches:

    • Investigate the role of BRI3-BRI3BP interaction in recycling endosomal trafficking

    • Analyze how the interaction affects K-Ras4B membrane localization and signaling

    • Study the structural basis of interactions using purified protein domains

    • Develop small molecule modulators of the interaction as research tools

  • Data Integration:

    • Combine multiple methodologies (biochemical, imaging, functional) to build a comprehensive model

    • Use computational approaches to predict interaction interfaces and test experimentally

    • Consider systems biology approaches to place the interaction in broader signaling networks
      By implementing this experimental framework, researchers can systematically characterize how BRI3 and BRI3BP function together and potentially identify new therapeutic targets in pathways related to K-Ras signaling .

What considerations are important when comparing BRI3 expression and function across different species models?

BRI3 is conserved across multiple species, including human, mouse, rat, and ferret, making cross-species comparisons valuable but potentially challenging. Researchers should consider the following factors:

  • Sequence Homology Analysis:

    • Perform detailed sequence alignments to identify conserved domains and species-specific variations

    • Focus experimental designs on highly conserved regions for cross-species applicability

    • Consider generating species-specific reagents for regions with significant divergence

  • Expression Pattern Differences:

    • Compare tissue distribution profiles across species using validated species-specific antibodies

    • Evaluate developmental expression timing, which may vary between species

    • Consider species-specific regulatory mechanisms that may affect expression levels

  • Reagent Cross-Reactivity:

    • Problem: Antibodies developed against one species may have variable reactivity with others

    • Solution: Validate each antibody specifically for the species being studied

    • Best Practice: Include appropriate positive controls from the target species in each experiment

  • Functional Conservation Assessment:

    ApproachPurposeImplementation
    Complementation studiesTest functional equivalenceExpress one species' protein in another species' knockout background
    Domain swappingIdentify species-specific functional regionsCreate chimeric proteins with domains from different species
    Comparative interactomicsMap species-specific interaction networksPerform parallel IP-MS studies in multiple species
  • Model System Selection:

    • For basic mechanistic studies, use models with well-characterized BRI3 function (e.g., mouse)

    • For therapeutic development, consider humanized models to improve translational relevance

    • When studying specialized functions, select species models that best recapitulate human physiology for the system of interest

  • Data Interpretation Caution:

    • Be aware that protein-protein interactions may differ between species despite sequence conservation

    • Consider that subcellular localization patterns might vary across species

    • Recognize that knockout phenotypes may differ in severity between species due to compensatory mechanisms
      By systematically addressing these considerations, researchers can develop more robust cross-species experimental designs and improve the translational relevance of their findings on BRI3 function .

What are the most promising avenues for therapeutic targeting of BRI3-related pathways?

The emerging understanding of BRI3 and its role in signaling pathways, particularly through BRI3BP and K-Ras interactions, suggests several promising therapeutic strategies:

  • Targeting BRI3BP-K-Ras Interactions:

    • Development of small molecule inhibitors that disrupt the interaction between BRI3BP and K-Ras

    • Peptide-based approaches mimicking critical binding interfaces

    • Allosteric modulators that alter BRI3BP conformation to prevent K-Ras binding

    • These approaches may provide more selective targeting of oncogenic K-Ras signaling than direct Ras inhibitors

  • Modulating Endosomal Trafficking:

    • Given BRI3BP's role in the recycling endosomal compartment, compounds that selectively alter this trafficking pathway

    • Targeted degraders (PROTACs) directed at BRI3 or BRI3BP to reduce K-Ras membrane localization

    • Nanobody-based approaches to sequester BRI3BP away from its functional locations

  • Signaling Pathway Intersection:

    • Combination approaches targeting both BRI3-related pathways and conventional Ras effectors

    • Synthetic lethality screening to identify vulnerabilities in cells dependent on BRI3-BRI3BP-K-Ras axis

    • Exploration of how BRI3 pathways intersect with other oncogenic drivers beyond K-Ras

  • Neurological Applications:

    • Investigation of BRI3's role in neuroinflammation, given its upregulation by TNF-α

    • Development of CNS-penetrant modulators of BRI3 function for potential neurological applications

    • Exploration of BRI3's contribution to neuronal membrane protein trafficking

  • Biomarker Development:

    • Validation of BRI3 or BRI3BP expression as predictive biomarkers for response to Ras pathway inhibitors

    • Development of imaging agents to visualize BRI3-dependent processes in vivo

    • Liquid biopsy approaches to monitor BRI3-related signaling activity
      These therapeutic strategies represent promising areas for future research, particularly in oncology where selective targeting of K-Ras signaling remains a significant unmet need .

What are the critical unanswered questions about BRI3 function in normal physiology and disease?

Despite recent advances in understanding BRI3 and its binding partners, several fundamental questions remain unanswered:

  • Physiological Functions:

    • What is the primary physiological role of BRI3 in neural tissues?

    • How is BRI3 expression and function regulated during development and in response to stimuli?

    • Does BRI3 have functions independent of its interaction with BRI3BP?

    • What is the significance of BRI3's upregulation by TNF-α in brain endothelial cells?

  • Molecular Mechanisms:

    • What is the complete interactome of BRI3 beyond BRI3BP?

    • How does BRI3 contribute to endosomal trafficking of membrane proteins?

    • What post-translational modifications regulate BRI3 function?

    • What is the three-dimensional structure of BRI3 and how does it inform function?

  • Pathological Implications:

    • Is BRI3 dysregulation a driver or consequence in neurodegenerative diseases?

    • How does the BRI3-BRI3BP axis contribute to cancer progression beyond K-Ras signaling?

    • Are there specific disease contexts where BRI3 represents a valuable therapeutic target?

    • How does BRI3 function change in response to cellular stress or inflammatory conditions?

  • Translational Questions:

    • Can modulation of BRI3 function provide therapeutic benefit in K-Ras-driven cancers?

    • Does BRI3 expression correlate with prognosis or treatment response in specific cancers?

    • Are there genetic variants of BRI3 associated with disease susceptibility?

    • How conserved are BRI3 functions between mouse models and humans?

  • Technical Challenges:

    • What are the best approaches for studying membrane-associated proteins like BRI3?

    • How can we develop more specific tools to modulate BRI3 function without affecting related proteins?

    • What in vivo models best recapitulate the physiological functions of BRI3?
      Addressing these critical questions will require interdisciplinary approaches combining structural biology, cell biology, genetics, and translational research. The answers may provide new insights into fundamental cellular processes and potentially reveal novel therapeutic opportunities .

How can integrative multi-omics approaches advance our understanding of BRI3 biology?

Integrative multi-omics strategies offer powerful approaches to comprehensively understand BRI3's role in cellular processes and disease contexts:

  • Genomics Integration:

    • Genome-wide CRISPR screens to identify synthetic lethal partners of BRI3

    • eQTL analysis to identify genetic variants affecting BRI3 expression

    • Comparative genomics across species to identify conserved regulatory elements

    • ChIP-seq to map transcription factors regulating BRI3 expression

  • Transcriptomics Applications:

    • RNA-seq following BRI3 modulation to map downstream transcriptional networks

    • Single-cell transcriptomics to resolve cell-type specific functions

    • Spatial transcriptomics to map BRI3 expression in complex tissues like brain

    • Alternative splicing analysis to identify tissue-specific BRI3 isoforms

  • Proteomics Approaches:

    • Proximity labeling (BioID, APEX) to map the BRI3 interactome in different cellular compartments

    • Phosphoproteomics to identify signaling changes downstream of BRI3-BRI3BP

    • Thermal proteome profiling to identify proteins stabilized by BRI3 interactions

    • Quantitative proteomics comparing wild-type and BRI3 knockout models

  • Metabolomics Integration:

    • Assessment of how BRI3-mediated signaling affects cellular metabolism

    • Identification of metabolic vulnerabilities in cells dependent on BRI3 function

    • Investigation of potential roles for BRI3 in metabolic regulation

  • Multi-omics Data Integration:

    Integration ApproachPurposeImplementation
    Network analysisMap BRI3-centered functional networksCombine protein interaction, gene expression, and genetic data
    Systems biology modelingPredict BRI3 function in different contextsDevelop mathematical models integrating multiple data types
    Machine learningIdentify patterns and predictive signaturesApply AI approaches to multi-dimensional omics datasets
    Pathway enrichmentConnect BRI3 to biological processesPerform integrated pathway analysis across omics layers
  • Translational Multi-omics:

    • Patient sample profiling across omics platforms to identify BRI3-related disease signatures

    • Drug response prediction based on BRI3 pathway activity

    • Biomarker development combining genomic, transcriptomic, and proteomic features
      These integrative approaches can reveal unexpected connections between BRI3 and other cellular processes, provide context for its role in different tissues and disease states, and potentially identify novel therapeutic targets within BRI3-related pathways .

What are the best experimental controls when studying BRI3 in mouse models?

Rigorous experimental controls are essential for generating reliable data on BRI3 function in mouse models:

  • Genetic Controls:

    • Wild-type littermates: Always use littermate controls matched for age, sex, and genetic background

    • Heterozygous controls: Include heterozygous animals to detect gene dosage effects

    • Conditional knockouts: Use Cre-negative floxed animals as controls for conditional knockouts

    • Rescue controls: Reintroduce wild-type BRI3 to confirm phenotype specificity

  • Antibody Validation Controls:

    • Knockout tissue: Use BRI3 knockout tissues as negative controls for antibody specificity

    • Overexpression samples: Include BRI3 overexpressing samples as positive controls

    • Blocking peptides: Use immunizing peptides to confirm antibody specificity

    • Multiple antibodies: Validate findings with independent antibodies targeting different epitopes

  • Experimental Design Controls:

    • Batch effects: Distribute experimental and control samples across multiple experimental batches

    • Blinding: Ensure investigators are blinded to genotype during data collection and analysis

    • Technical replicates: Include technical replicates to assess method variability

    • Biological replicates: Use sufficient biological replicates (typically n≥5 per group) for statistical power

  • Assay-Specific Controls:

    Assay TypeEssential Controls
    Western blottingLoading controls (β-actin, GAPDH), molecular weight markers, no-primary antibody
    ELISAStandard curve controls, blank wells, dilution linearity check
    IHC/IFSecondary-only controls, isotype controls, competing peptide controls
    qPCRNo-RT controls, reference gene controls, standard curves
  • In vivo Experiment Considerations:

    • Environmental controls: Maintain consistent housing, diet, and handling conditions

    • Age-matched cohorts: Control for developmental and aging effects

    • Sex-balanced groups: Include both male and female mice unless specifically studying sex differences

    • Microbiome considerations: Consider co-housing or littermate controls to minimize microbiome variation
      By implementing these comprehensive controls, researchers can significantly increase confidence in the specificity and reliability of their findings on BRI3 function in mouse models .

How can researchers effectively combine in vitro and in vivo approaches to study BRI3 function?

A comprehensive understanding of BRI3 function requires complementary in vitro and in vivo approaches that build upon each other's strengths and address respective limitations:

  • Sequential Experimental Design:

    • Start with in vitro systems to establish molecular mechanisms and generate specific hypotheses

    • Validate key findings in increasingly complex models (cell lines → primary cultures → organoids → in vivo)

    • Return to simplified systems to investigate mechanistic details of in vivo observations

  • Parallel Validation Strategy:

    • Test the same hypothesis simultaneously in multiple systems

    • Compare results across models to identify conserved vs. context-dependent effects

    • Reconcile discrepancies through additional targeted experiments

  • Complementary Technology Application:

    In Vitro ApproachComplementary In Vivo ApproachCombined Insight
    CRISPR knockout in cell linesConditional knockout mouse modelsCell-autonomous vs. systemic effects
    Protein interaction studiesIn vivo proximity labelingContext-dependent interaction networks
    Signaling pathway analysisTissue-specific pathway activationPhysiological relevance of pathways
    Drug screeningIn vivo pharmacologyEfficacy, PK/PD relationships, toxicity
  • Translational Model Integration:

    • Patient-derived cell lines coupled with patient-derived xenografts

    • Humanized mouse models expressing human BRI3 variants

    • Primary human cell cultures compared with analogous mouse cells

    • Organoids derived from multiple species to assess cross-species conservation

  • Advanced In Vitro Models:

    • 3D organoids to better recapitulate tissue architecture

    • Co-culture systems to model cell-cell interactions

    • Microfluidic "organ-on-chip" platforms for dynamic conditions

    • These approaches bridge the gap between traditional in vitro systems and in vivo complexity

  • Data Integration Framework:

    • Develop computational models that integrate data from multiple experimental systems

    • Use machine learning approaches to identify patterns across model systems

    • Implement formal meta-analysis methods when comparing results across models
      This integrated approach leverages the mechanistic detail possible in vitro with the physiological relevance of in vivo models, providing a more complete understanding of BRI3 function in health and disease .

What considerations are important when developing new tools and reagents for BRI3 research?

The development of specific, well-validated tools and reagents is critical for advancing BRI3 research. Researchers should consider the following factors when developing or selecting research tools:

  • Antibody Development and Validation:

    • Epitope selection: Target unique regions of BRI3 to minimize cross-reactivity

    • Validation criteria: Validate using multiple techniques (WB, IP, IF) and appropriate controls

    • Species cross-reactivity: Test reactivity across relevant species (human, mouse, rat)

    • Application optimization: Determine optimal conditions for each application (e.g., 1:500-1:1000 for WB)

  • Recombinant Protein Production:

    • Expression system selection: Choose systems capable of proper folding and post-translational modifications

    • Purification strategy: Develop methods that maintain native conformation

    • Quality control: Implement rigorous purity and activity assessments

    • Storage optimization: Determine conditions that maintain stability (e.g., -20°C with 50% glycerol)

  • Genetic Tool Development:

    • CRISPR guide design: Target conserved, functional domains while minimizing off-target effects

    • Conditional systems: Develop inducible or tissue-specific expression/knockout systems

    • Reporter constructs: Create fusion proteins that maintain native function

    • Validation: Confirm genetic modifications at DNA, RNA, and protein levels

  • Detection Assay Development:

    Assay TypeCritical Considerations
    ELISASpecies specificity, detection range (0.156-10 ng/ml), sample compatibility
    Activity assaysFunctional readouts relevant to BRI3 biology
    High-throughput screensRobust Z-factor, minimal false positives/negatives
    Imaging probesSpecificity, sensitivity, signal-to-noise ratio
  • Documentation and Distribution:

    • Detailed protocols: Provide complete methodology for reproducibility

    • Reagent sharing: Make tools available to the research community

    • Database deposition: Submit sequences, structures, and validation data to repositories

    • Transparent limitations: Clearly document known limitations of each tool

  • Translational Considerations:

    • Develop tools that work across model systems to facilitate translation

    • Create humanized reagents when appropriate for clinical applications

    • Consider diagnostic potential when developing detection methods

    • Assess compatibility with clinical sample types
      By attending to these considerations, researchers can develop and select high-quality tools and reagents that advance the reliability and impact of BRI3 research, while avoiding common pitfalls such as antibody cross-reactivity or functional interference from tags .

How might emerging technologies transform our understanding of BRI3 function in the next decade?

The rapid advancement of molecular and cellular technologies is poised to dramatically enhance our understanding of BRI3 biology over the next decade through several transformative approaches:

  • Structural Biology Breakthroughs:

    • AlphaFold and deep learning: Prediction of BRI3 structure and interaction interfaces

    • Cryo-EM advances: Determination of BRI3 membrane protein complexes at near-atomic resolution

    • Integrative structural biology: Combining multiple structural methods to map dynamic conformational changes

    • These approaches will provide unprecedented molecular insights into BRI3 function and interactions

  • Spatially Resolved Single-Cell Technologies:

    • Spatial transcriptomics: Mapping BRI3 expression patterns with cellular resolution in intact tissues

    • Multiplexed imaging: Visualizing BRI3 protein alongside dozens of other markers simultaneously

    • Single-cell proteomics: Quantifying BRI3 protein levels and modifications at single-cell resolution

    • These methods will reveal cell-type specific functions and heterogeneity in BRI3 biology

  • Genome Engineering Innovations:

    • Base and prime editing: Precise introduction of disease-relevant BRI3 variants

    • In vivo CRISPR screens: Systematic functional analysis of BRI3 in complex tissues

    • Epigenome editing: Targeted modulation of BRI3 expression without genetic changes

    • These techniques will enable unprecedented precision in manipulating BRI3 function

  • Artificial Intelligence Applications:

    AI ApplicationImpact on BRI3 Research
    Network inferenceIntegration of multi-omics data to predict BRI3 functions
    Drug discoveryDesign of small molecules targeting BRI3-related pathways
    Image analysisAutomated quantification of BRI3 localization and trafficking
    Literature miningSystematic extraction of BRI3 knowledge from published research
  • Translational Technologies:

    • Organoid biobanks: Patient-derived models to study BRI3 in human disease contexts

    • In situ sequencing: Direct visualization of BRI3 mRNA in preserved clinical samples

    • Liquid biopsy innovations: Detection of BRI3-related biomarkers in minimally invasive samples

    • Precision medicine approaches: Targeting BRI3 pathways based on individual patient profiles

  • Systems Biology Integration:

    • Comprehensive mathematical modeling of BRI3's role in cellular networks

    • Predictive simulations of perturbation effects on BRI3-dependent processes

    • Multi-scale modeling connecting molecular interactions to tissue-level phenotypes
      These emerging technologies will collectively transform BRI3 research from its current state of basic characterization to a comprehensive understanding of its dynamic functions in health and disease, potentially revealing new therapeutic opportunities .

What are the key methodological recommendations for researchers beginning work on mouse BRI3?

For researchers beginning work on mouse BRI3, the following methodological recommendations will help establish a robust research program and avoid common pitfalls:

  • Initial Characterization Strategy:

    • Start with expression profiling across tissues and developmental stages

    • Establish reliable detection methods for both protein and mRNA

    • Validate commercial antibodies thoroughly before extensive use

    • Create a panel of positive control samples (e.g., brain tissue lysates)

  • Genetic Tool Development:

    • Generate or obtain BRI3 knockout models as negative controls

    • Consider conditional knockout approaches for tissue-specific studies

    • Develop tagged versions of BRI3 that maintain functionality

    • Validate all genetic models at DNA, RNA, and protein levels

  • Experimental Design Principles:

    PrincipleImplementation
    ReproducibilityStandardize protocols, use biological and technical replicates
    RigorInclude appropriate positive and negative controls for all experiments
    ValidationConfirm key findings using orthogonal methods
    DocumentationMaintain detailed records of all experimental conditions
  • Technical Approach Recommendations:

    • For protein detection, use Western blotting with validated antibodies at 1:500-1:1000 dilution

    • For quantitative analysis, employ ELISA with samples diluted to the mid-range of detection (0.156-10 ng/ml)

    • For subcellular localization, combine biochemical fractionation with imaging approaches

    • For interaction studies, start with GST pull-down assays and confirm with co-immunoprecipitation

  • Contextual Research Framework:

    • Study BRI3 in the context of its binding partners, particularly BRI3BP

    • Consider connections to Ras signaling pathways, especially K-Ras4B

    • Investigate roles in recycling endosomal compartments

    • Explore functions in both neuronal and non-neuronal contexts

  • Collaborative Strategy:

    • Establish collaborations with complementary expertise (e.g., structural biology, in vivo models)

    • Engage with the broader Ras signaling community

    • Share reagents and protocols to advance the field collectively

    • Consider depositing data in public repositories to maximize impact
      By following these methodological recommendations, new researchers can establish a solid foundation for BRI3 research, build upon existing knowledge effectively, and make meaningful contributions to this emerging field .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.