Recombinant Mouse C-C chemokine receptor 1-like protein 1 (Ccr1l1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse C-C Chemokine Receptor 1-Like Protein 1 (Ccr1l1)

Ccr1l1 is a rodent-specific orphan G-protein-coupled receptor (GPCR) with structural and sequence homology to the CC chemokine receptors Ccr1 and Ccr3 . It encodes a 356-amino-acid protein (41 kDa predicted molecular weight) and is expressed predominantly in eosinophils and macrophages . Recombinant Ccr1l1 is produced via bacterial expression systems, typically with N-terminal His tags for purification purposes .

Expression and Localization

Ccr1l1 expression is restricted to rodentia, with no orthologs in humans or other mammals . Key findings:

  • Cellular Expression:

    • Primary: Eosinophils (highest expression) and bone-marrow-derived macrophages .

    • Secondary: Splenic non-B/non-T cells (e.g., dendritic cells) .

  • Tissue Distribution: Chromosome 9 in mice, adjacent to Ccr1 and Ccr3 genes .

  • Membrane Localization: Recombinant Ccr1l1 is plasma membrane-associated in transfected HEK293 cells, confirmed by FACS and fluorescence microscopy .

Ligand Screening and Signaling

Despite extensive testing with 37 mouse chemokines (e.g., CCL3, CCL5, CCL9) and viral chemokines, no ligands were identified for Ccr1l1 . Key assays used:

Assay TypeCcr1l1 ResponseCcr1 Response
Receptor InternalizationNegativePositive
β-Arrestin RecruitmentNegativePositive
Calcium FluxNegativePositive
ChemotaxisNegativePositive

Ccr1l1 lacks constitutive signaling activity observed in Ccr1 .

Knockout Studies

  • Eosinophil Phenotype: Normal development, survival, and chemokine responsiveness in Ccr1l1−/− mice .

  • Immune Function: No defects in neutrophil, macrophage, or T-cell responses in naïve mice .

Immunological Studies

  • Eosinophil Function: Potential role in eosinophil-driven immune responses, though not essential .

  • Neuroinflammation: Ccr1l1 may modulate microglial or astrocyte activity, but evidence remains speculative .

Production and Purification of Recombinant Ccr1l1

ParameterSpecificationSource
Expression SystemE. coli
TagN-terminal 10xHis
Purity>85% (SDS-PAGE validated)
ApplicationsSDS-PAGE, signaling assays

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Ccr1l1; Cmkbr1l1; C-C chemokine receptor 1-like protein 1; Macrophage inflammatory protein 1 alpha receptor-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ccr1l1
Target Protein Sequence
MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLVFIIGVIGHVLVVLVL IQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGNAMCKFVSGFYYLGLYS DMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAALVSIPCLYVFKSQMEFT YHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMR LIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVDLSLMITEALAYTHCCVNPV IYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRASATPPSTVEIETSADL
Uniprot No.

Target Background

Function
This protein is a probable receptor for a C-C type chemokine.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in the spleen, liver and leukocytes.

Q&A

What is Ccr1l1 and how does it relate to other chemokine receptors?

Ccr1l1 (C-C chemokine receptor 1-like protein 1) is a Rodentia-specific G protein-coupled receptor that shows high homology to Ccr1 and Ccr3, particularly Ccr1, from which it appears to have evolved directly. Phylogenetic analyses place Ccr1l1 in the CC chemokine receptor subfamily, sharing a common ancestor with Ccr1 and Ccr3 .

Structurally, Ccr1l1 preserves key features of chemokine receptors, including the canonical DRYLAIV sequence of the DRY motif (with most rodent Ccr1l1 orthologs encoding a DRYLAVV sequence), which is critical for G-protein coupling . This sequence is also found in human CCR8 and CCR5, suggesting potential functional similarities despite the absence of a direct human ortholog.

Unlike broadly conserved chemokine receptors, Ccr1l1 is restricted to rodent species, with orthologs identified in at least ten rodent species showing amino acid identities >78% . This restricted distribution suggests a specialized function that may have evolved to address rodent-specific immune challenges.

What is known about Ccr1l1 expression patterns in rodents?

Ccr1l1 exhibits a highly selective expression pattern, predominantly in eosinophils . This cell-specific expression suggests a potential role in eosinophil-mediated immune responses, though knockout studies have revealed normal eosinophil phenotypes, development, and chemokine responsiveness in naïve Ccr1l1 knockout mice under standard laboratory conditions .

The restricted expression in eosinophils contrasts with Ccr1, which is expressed on multiple immune cell types including monocytes, macrophages, neutrophils, and certain lymphocyte subsets . This differential expression pattern may indicate a specialized function in allergic responses or parasite immunity, areas where eosinophils play crucial roles.

For researchers investigating Ccr1l1 expression, it is advisable to employ complementary approaches:

  • Single-cell RNA sequencing to identify potentially rare cell populations expressing this receptor

  • Flow cytometry with specific antibodies to confirm protein expression at the cellular level

  • Tissue-specific expression analysis under various inflammatory conditions to identify contexts where expression might be upregulated

What structural features define Ccr1l1 as a functional GPCR?

Ccr1l1 maintains the core structural architecture characteristic of the chemokine receptor subfamily of GPCRs. Experimental evidence confirms that Ccr1l1 can be expressed on the plasma membrane with the correct topological orientation (extracellular N-terminus and intracellular C-terminus) , which is essential for GPCR function.

Key structural features preserved in Ccr1l1 include:

  • Seven-transmembrane domain architecture, confirmed by structural modeling

  • The highly conserved DRY motif (DRYLAIV/DRYLAVV sequence) at the intracellular end of transmembrane helix III

  • Two conserved extracellular disulfide bridges (TMVII-N-terminus and TMIII-ECL2)

  • The β-hairpin fold typically observed in the second extracellular loop (ECL2) of chemokine receptors

These structural elements collectively suggest that Ccr1l1 maintains the capacity to function as a genuine chemokine receptor, potentially coupling to G proteins to initiate downstream signaling cascades, despite the current lack of identified natural ligands.

What methodologies have been employed to investigate Ccr1l1 function?

Researchers have utilized multiple complementary approaches to investigate Ccr1l1 function, though definitive functional characterization remains elusive. Table 1 summarizes key methodologies and their findings:

Table 1: Methodologies for Studying Ccr1l1 Function

Methodology CategorySpecific TechniquesKey Findings
Genetic ApproachesGeneration of knockout miceNormal eosinophil phenotypes in naïve mice
Phylogenetic analysisCcr1l1 evolved from Ccr1, restricted to rodents
Expression StudiesTransfection with epitope-tagged constructsSuccessfully expressed on plasma membrane
Immunofluorescence microscopyConfirmed extracellular N-terminus, intracellular C-terminus
Flow cytometryQuantified surface expression levels
Functional AssaysReceptor internalization assaysNo internalization with 37 tested chemokines
β-arrestin recruitment assaysNo recruitment with tested ligands
Calcium flux assaysNo calcium signals with tested ligands
Chemotaxis assaysNo chemotactic response with tested ligands

Despite systematic screening of 37 available mouse chemokines and two viral chemokines, no natural ligand has been identified for Ccr1l1 . This suggests either that its ligand was not among those tested or that it may have unique activation requirements or context-dependent function.

For researchers seeking to further investigate Ccr1l1 function, complementing these established methodologies with newer approaches is recommended:

  • CRISPR-Cas9 genome editing for more precise genetic manipulation

  • Phosphoproteomics to identify potential downstream signaling targets

  • In vivo disease models challenging Ccr1l1-knockout mice with various immunological stimuli

  • Single-cell analysis to identify contexts where Ccr1l1 might be functionally important

How do Ccr1l1 knockout models differ from wild-type in immune response assays?

Studies with Ccr1l1 knockout mice have yielded surprising results. Under basal conditions in naïve mice, knockout of Ccr1l1 did not result in observable phenotypic changes :

  • Eosinophil phenotypes appeared normal

  • Eosinophil development proceeded without apparent defects

  • Responsiveness to chemokines remained intact

This lack of obvious phenotype under standard laboratory conditions suggests several possibilities:

  • Functional redundancy with other chemokine receptors compensating for Ccr1l1 deficiency

  • Context-specific functions that become apparent only under particular immune challenges

  • Subtle phenotypes requiring more sensitive detection methods

To uncover potential functions of Ccr1l1, researchers should consider challenging knockout models with various immune stimuli specifically relevant to eosinophil biology:

  • Allergic inflammation models (e.g., ovalbumin-induced airway inflammation)

  • Helminth infection models where eosinophils play key roles

  • Diverse pathogen challenges including bacterial, viral, or fungal infections

  • Autoimmune disease models to examine potential roles in pathological immune responses

A comprehensive immunophenotyping approach combining flow cytometry, cytokine/chemokine profiling, histopathology, and in vivo imaging would provide the most complete assessment of any subtle differences between wild-type and Ccr1l1 knockout mice.

What signaling pathways might be activated downstream of Ccr1l1?

While definitive signaling pathways for Ccr1l1 have not been experimentally confirmed due to the lack of identified natural ligands, its structural similarities to other chemokine receptors, particularly Ccr1, allow for informed predictions:

Table 2: Predicted Signaling Pathways for Ccr1l1

Pathway TypeSignaling ComponentsPotential Functional Outcomes
G Protein-CoupledGαi/o proteinsInhibition of adenylyl cyclase, decreased cAMP
Gβγ subunitsActivation of phospholipase C (PLC)
Calcium signalingMobilization from intracellular stores
PI3K activationCell migration, survival signals
β-Arrestin-DependentMAP kinase cascadesERK1/2, p38, JNK activation
Src family kinasesTyrosine phosphorylation events
Akt signalingCell survival, metabolic regulation
Cellular ResponsesActin cytoskeletonChemotaxis/cell migration
Transcriptional regulationExpression of immune response genes
Eosinophil granule releaseRelease of inflammatory mediators
Adhesion molecule expressionRegulation of cell adhesion and migration

The presence of the conserved DRY motif strongly suggests Ccr1l1 can couple to G proteins . Based on related chemokine receptors, Ccr1l1 likely couples primarily to Gαi/o proteins, potentially leading to inhibition of adenylyl cyclase and activation of downstream pathways through released Gβγ subunits.

To experimentally validate these potential signaling pathways, researchers should employ:

  • Phosphoproteomic analysis of cells expressing Ccr1l1 following stimulation

  • Western blotting for phosphorylated signaling intermediates

  • BRET/FRET-based biosensors to detect protein-protein interactions

  • Genetic approaches (siRNA, CRISPR) to confirm signaling component requirements

How can researchers determine potential natural ligands for Ccr1l1?

Identifying natural ligands for orphan receptors like Ccr1l1 requires a systematic, multi-faceted approach:

Table 3: Strategies for Identifying Ccr1l1 Ligands

ApproachMethodologiesConsiderations
Phylogenetic AnalysisTesting ligands of related receptorsFocus on Ccr1 and Ccr3 ligands, particularly CCL9/10
Testing structural variantsN-terminal truncations, post-translational modifications
High-Throughput ScreeningLigand library screeningComprehensive chemokine libraries, rodent-specific variants
Reporter cell linesExpression of Ccr1l1 with various signaling readouts
Tissue extract fractionationFrom inflammatory conditions or eosinophil-rich tissues
Bioinformatic PredictionMolecular docking simulationsUsing homology models of Ccr1l1
Machine learning approachesTrained on known chemokine-receptor interactions
Biochemical ApproachesPull-down assaysUsing purified Ccr1l1 N-terminal domain as bait
Direct binding assaysSurface plasmon resonance (SPR), bio-layer interferometry
In vivo ApproachesReporter miceExpression of fluorescent proteins under Ccr1l1 promoter
Challenge modelsIdentification of activating inflammatory conditions

Given that Ccr1l1 is selectively expressed in eosinophils , researchers should particularly focus on contexts where eosinophils are activated, such as allergic inflammation or parasite infections, as these may provide clues to natural ligands.

MIP-1gamma (CCL9/10), which is known to signal through CCR1 , represents an interesting starting point despite initial negative results, as structural variants or context-dependent interactions might still occur with Ccr1l1.

What are the differences between Ccr1 and Ccr1l1 in terms of ligand binding specificity?

Despite high sequence similarity, Ccr1 and Ccr1l1 appear to have distinct ligand binding profiles:

Table 4: Comparison of Ccr1 and Ccr1l1 Ligand Binding Properties

The surprising finding that Ccr1l1 does not respond to any of the tested chemokines, including Ccr1 ligands , suggests that despite evolutionary relatedness, Ccr1l1 has evolved distinct ligand recognition properties. These differences likely result from key amino acid variations in:

  • The N-terminal domain, critical for initial chemokine recognition

  • The extracellular loops, particularly ECL2, which form part of the binding pocket

  • The transmembrane helices that shape the ligand binding cavity

To elucidate the structural basis for these differences, researchers should consider:

  • Creating chimeric receptors swapping domains between Ccr1 and Ccr1l1

  • Site-directed mutagenesis targeting specific amino acid differences

  • Comparative structural modeling and molecular dynamics simulations

  • Direct binding studies with purified receptor components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.