Recombinant Mouse C-C chemokine receptor type 10 (Ccr10)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

Recombinant Mouse Ccr10 is typically available as a lyophilized powder with high purity levels exceeding 85-90% as determined by SDS-PAGE analysis . The protein is stored in buffer solutions such as Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage . For research applications, the protein requires reconstitution, typically in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommendations to add 5-50% glycerol for long-term storage at -20°C/-80°C .

Receptor-Ligand Interactions

Ccr10 functions primarily by binding to specific chemokines, particularly CCL27 and CCL28, which are its natural ligands. Studies have demonstrated that both human and mouse CCL28 can induce calcium mobilization in CCR10-expressing transfectants, indicating conservation of function across species . This interaction is critical for immune cell trafficking and inflammatory responses. Notably, CCL28 can desensitize calcium mobilization induced by CCL27 in CCR10 transfectants, suggesting that these chemokines share this receptor .

Signaling Mechanisms

The binding of ligands to Ccr10 triggers intracellular signaling cascades that regulate various cellular functions. Research has revealed that Ccr10 activation leads to phosphorylation of Akt, resulting in increased PCNA (Proliferating Cell Nuclear Antigen) expression and enhanced cell proliferation . This PI3K/Akt pathway activation appears to be a critical downstream mechanism through which Ccr10 exerts its biological effects, particularly in inflammatory contexts .

Expression Patterns

Ccr10 expression is regulated by various inflammatory stimuli. Studies have shown that TNF (Tumor Necrosis Factor) can significantly upregulate Ccr10 expression in hepatocytes and cell lines, indicating its responsiveness to inflammatory signals . Additionally, TNF stimulation leads to increased secretion of CCL28, the natural ligand of Ccr10, creating a potential autocrine signaling loop .

CCR10 Knockout Models

To investigate the functional significance of Ccr10, researchers have developed CCR10 knockout mouse models. These models have been instrumental in elucidating the role of Ccr10 in various physiological and pathological processes.

The generation of CCR10-knockout/EGFP-knockin mice typically involves replacing the CCR10 coding sequence with an EGFP coding sequence . The targeting construct consists of:

  1. A 5' arm (typically a 3.6-kb fragment upstream of the CCR10 start codon)

  2. The EGFP coding sequence

  3. A loxP-flanked neo cassette

  4. A 3' arm containing a portion of CCR10 and a 3' noncoding region

This approach results in deletion of a 1.7-kb DNA fragment coding for the N-terminal extracellular domain and all seven transmembrane domains of CCR10, effectively eliminating its function while allowing for visualization of cells that would normally express CCR10 through EGFP fluorescence .

Role in Inflammation-Driven Hepatocarcinogenesis

One of the most significant research findings regarding Ccr10 involves its role in inflammation-driven hepatocarcinogenesis. Studies using diethylnitrosamine (DEN)-induced murine models have demonstrated that CCR10 knockout mice exhibit:

  1. Significantly lower liver weight/body weight ratio

  2. Significantly lower liver tumor incidence

  3. Significantly smaller tumors compared to wild-type mice

These findings suggest that Ccr10 contributes to hepatocarcinogenesis through several mechanisms:

ParameterWild-Type MiceCCR10 Knockout MiceStatistical Significance
Liver weight/body weight ratioHigherLowerSignificant (p<0.05)
Tumor incidenceHigherLowerSignificant (p<0.05)
Mean tumor sizeLargerSmallerSignificant (p<0.05)
Hepatocellular apoptosisLowerHigherSignificant (p<0.05)
Compensatory proliferationHigherLowerSignificant (p<0.05)

The data demonstrates that CCR10 reduces inflammation-driven hepatocellular apoptosis and promotes compensatory proliferation, but does not significantly affect upstream neutrophilic infiltration .

T Cell Trafficking Enhancement

Another important application of Recombinant Mouse Ccr10 is in enhancing T cell trafficking, particularly in the context of cancer immunotherapy. Research has shown that CCR10 overexpression in T cells can significantly improve their migratory capacity toward CCL28, which is often upregulated in solid tumors such as breast and lung cancer .

The chemotaxis index (movement of cells in response to a chemical stimulus) was found to be approximately 3.8 times higher at a CCL28 concentration of 600 ng and increased to 4.4 times higher at a concentration of 1,200 ng in cells with 25% CCR10 receptor expression . This represents a significant improvement over other chemokine receptor systems tested in similar contexts.

Functional Conservation

Both human and mouse CCR10 respond to their respective CCL28 ligands by inducing calcium mobilization, indicating functional conservation across species . Moreover, in vitro studies have shown that recombinant human CCL28 displays chemotactic activity for resting CD4 or CD8 T cells, a function that is likely preserved in mouse models as well .

Protein Reconstitution and Handling

For optimal research results, proper handling of Recombinant Mouse Ccr10 is essential. The lyophilized protein should be reconstituted to a concentration of 0.1-1.0 mg/mL in deionized sterile water, with the recommendation to add 5-50% glycerol for long-term storage . Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity.

Purity and Quality Control

The purity of Recombinant Mouse Ccr10 is typically determined by SDS-PAGE analysis, with commercial preparations achieving greater than 85-90% purity . This high purity is essential for ensuring reliable research results and minimizing interference from contaminants.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your requests as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
Ccr10; Cmkbr9; Gpr2; C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; Chemokine C-C receptor 9; G-protein coupled receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGTKPTEQVSWGLYSGYDEEAYSVGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLAGNG LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY SASFHAGFLFLACISADRYVAIARALPAGQRPSTPSRAHLVSVFVWLLSLFLALPALLFS RDGPREGQRRCRLIFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL VRCSLNPVLYAFLGLRFRRDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSLSW DN
Uniprot No.

Target Background

Function
CCR10 acts as a receptor for chemokines SCYA27 and SCYA28. Upon activation, it transduces signals by increasing intracellular calcium ion levels.
Gene References Into Functions
  1. This study indicates that losartan and dexamethasone may suppress inflammatory responses in IgA nephropathy by inhibiting CCR10 expression in Th22 cells PMID: 27930971
  2. CCR10 plays a role in regulating innate and memory immune responses in the skin PMID: 24767879
  3. Our in vivo analysis demonstrated that uniform CCR10 expression on MSCs and altered CCL27 levels in the skin enhance extravasation of stem cells from circulation and facilitate their migration within cutaneous tissue PMID: 23321329
  4. These findings provide strong evidence that CCR10 is crucial for the development of skin intraepithelial Vgamma3(+) T lymphocytes PMID: 20937851
  5. Simultaneous blocking of CCR4 and CCR10, or their ligands, could be beneficial in treating T-cell-mediated skin diseases. PMID: 18095942
  6. CCR10 is critical for the efficient localization and accumulation of immunoglobulin A antibody-secreting cells in the lactating mammary gland. PMID: 18941222

Show More

Hide All

Database Links

KEGG: mmu:12777

STRING: 10090.ENSMUSP00000062588

UniGene: Mm.8021

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in small intestine, colon, lymph nodes, Peyer patches and at lower levels in thymus, lung and spleen.

Q&A

What is the basic structure and function of mouse CCR10?

Mouse CCR10 is a G protein-coupled receptor member of the CC chemokine subfamily. The protein is 362 amino acids in length with a predicted molecular weight of 38 kDa. Mouse and rat CCR10 share 88% amino acid sequence identity with the human protein. CCR10 functions primarily through binding to its ligands (notably CCL27 and CCL28), which activates G protein-mediated signaling cascades, including the Akt and NFκB pathways. This activation leads to cytoskeleton rearrangement and chemotactic cell migration, which is critical for proper immune cell homing and positioning .

Where is CCR10 predominantly expressed in mice, and how does this compare to humans?

In mice, CCR10 is predominantly expressed on IgA-producing plasma cells in mucosal tissues, particularly the intestine and lactating mammary gland. It is also found on specific subsets of skin-homing T cells. CCR10 expression is often low or absent on resting peripheral T cells but can be modulated during activation. In comparing mouse and human expression patterns, both species show similar tissue-specific expression profiles, though there are some differences in regulation that researchers should consider when extrapolating from mouse models to human applications .

What are the primary ligands for mouse CCR10 and their expression patterns?

The primary ligands for mouse CCR10 are CCL27 (CTACK) and CCL28 (MEC). CCL27 is predominantly expressed in skin keratinocytes and is involved in the recruitment of CCR10+ cells to the skin. CCL28 is expressed at mucosal sites, particularly in the intestine and lactating mammary gland, where it mediates the recruitment of IgA-secreting plasma cells. Research has shown that CCL28 expression is higher in certain tumor tissues compared to normal tissues, which has implications for cancer immunology research .

What methods are available for detecting CCR10 expression in mouse tissues and cells?

Several methods can be used to detect CCR10 expression:

  • Flow cytometry: Using specific anti-CCR10 antibodies such as rat monoclonal antibody (clone 248918) conjugated to fluorophores like PerCP. This approach allows for quantitative assessment of CCR10 expression at the single-cell level .

  • RT-PCR: Using specific primers (e.g., forward primer 5′-cattcacaccaaaggggtctt-3′ and reverse primer 5′-agcctctgtggctgtacctc-3′) to amplify CCR10 mRNA. The amplification profile typically involves 35 cycles of 94°C for 30 seconds, 55°C for 30 seconds, and 72°C for 30 seconds, followed by a 10-min extension at 72°C .

  • Reporter mouse models: Transgenic mice in which the CCR10 gene has been replaced with fluorescent reporters like EGFP allow for direct visualization of CCR10 expression without antibodies .

  • Western blotting: For protein-level detection in tissue or cell lysates.

When selecting a detection method, researchers should consider that surface CCR10 expression may be affected by enzymatic tissue digestion protocols, which can cleave the extracellular portions of the receptor .

How can I generate and validate CCR10-knockout mice for functional studies?

CCR10-knockout mice can be generated through targeted disruption of the first ATG codon of CCR10 by insertion of reporter/selection markers such as EGFP/NeoR. A detailed approach involves:

  • Design of targeting construct: Create a construct where the first ATG codon of CCR10 exon I is mutated into a restriction site (e.g., EcoRV) via PCR-directed mutagenesis.

  • Reporter insertion: Insert a reporter gene (such as EGFP) along with a selection marker (such as NeoR) at the mutated ATG site.

  • ES cell targeting: Introduce the linearized targeting vector into embryonic stem cells via electroporation (typically ~10^7 cells, 16 μg targeting vector, 400V at 25 μF).

  • Selection and verification: Select positive clones using appropriate antibiotics, and confirm homologous recombination by Southern blot analysis.

  • Blastocyst injection: Inject confirmed ES cells into blastocysts to generate chimeric mice.

  • Breeding: Cross chimeric mice with wild-type mice to achieve germline transmission.

  • Genotyping: Confirm knockout by PCR and/or Southern blot analysis of tail genomic DNA .

Validation should include functional assays to confirm the absence of CCR10-mediated responses, such as chemotaxis assays using CCL28 as a chemoattractant.

What recombinant expression systems are most effective for producing functional mouse CCR10 protein?

Several expression systems have been utilized to produce functional mouse CCR10:

  • Mammalian cell lines: Transient or stable transfection of HEK293 or CHO cells with CCR10 expression vectors provides properly folded and post-translationally modified receptor, though yields may be lower than other systems.

  • Lentiviral expression systems: Using vectors like FUGW lentiviral vector for stable integration and expression in target cells. This approach is particularly useful for engineering T cells to express CCR10 .

  • E. coli: While bacterial expression systems can produce high yields of protein, they often require refolding to achieve functionality and lack appropriate post-translational modifications.

For optimal results in functional studies, mammalian expression systems are generally preferred despite lower yields. When designing constructs, consider including purification tags that can be cleaved post-purification to avoid interference with receptor function .

How does CCR10 regulate intestinal IgA responses in mice, and what are the implications of CCR10 deficiency?

CCR10 plays a critical role in regulating intestinal IgA responses through several mechanisms:

  • Plasma cell positioning: CCR10 is essential for positioning IgA-producing plasma cells in the intestinal lamina propria, allowing for efficient secretion of IgA into the intestinal lumen.

  • IgA memory maintenance: CCR10 is required for the long-term maintenance of IgA-producing plasma cells and IgA+ memory B cells in the intestine following pathogen exposure.

Studies with CCR10-knockout mice have revealed complex consequences:

These findings highlight CCR10's essential role in intestinal immune memory maintenance rather than in primary IgA responses .

What is the significance of CCR10 in lactating mammary gland IgA production?

The lactating mammary gland model has been particularly valuable for studying CCR10 function because:

  • IgA antibody-secreting cells (ASCs) in the mammary gland lack expression of CCR3 (another receptor for CCL28), making CCR10 the sole receptor mediating their recruitment via CCL28.

  • Studies using CCR10-deficient mice have demonstrated that CCR10-mediated interactions are indispensable for efficient accumulation of high levels of IgA ASCs in the lactating mammary gland.

  • This model provides a clean system to study CCR10-specific effects without confounding factors from other chemokine receptors.

The significance extends to understanding maternal antibody transfer to offspring, as IgA in breast milk provides critical passive immunity to neonates. CCR10's role in this process makes it a potential target for strategies to enhance passive immunity transfer through breast milk .

How do CCR10 expression dynamics change during inflammation and immune cell activation?

CCR10 expression is dynamically regulated during inflammation and immune cell activation:

  • T cell activation: In activated human T cells, CCR10 expression shows a biphasic pattern, with an initial increase on day 4 post-activation, followed by a subsequent decrease. This temporal regulation is important when designing experiments with activated T cells .

  • Monocyte-to-macrophage differentiation: As monocytes differentiate into macrophages or dendritic cells, their chemokine receptor expression profile changes. While CCR2 expression predominates in Ly6C^hi monocytes, differentiation toward macrophages is accompanied by upregulation of CCR1 and CCR5 with concurrent downregulation of CCR2. This pattern has been elegantly demonstrated using inflammatory chemokine receptor reporter (iCCR-REP) mice .

  • Tissue inflammation: During inflammation, tissue-specific patterns of chemokine upregulation influence the recruitment of CCR10+ cells. For example, in inflammation-driven hepatocarcinogenesis, there is significant upregulation of the CCR10 ligand CCL28, which can recruit CCR10+ cells to the liver .

Understanding these dynamics is crucial for designing experiments targeting appropriate time points and for interpreting results in inflammatory disease models .

How can CCR10 be exploited to enhance T cell trafficking in adoptive cell therapy?

CCR10 has emerged as a promising candidate for improving T cell trafficking in adoptive cell therapy, particularly for targeting solid tumors. The strategy involves:

  • Identifying suitable targets: Analysis of chemokine expression in tumor tissues compared to normal tissues has identified CCL28 (the CCR10 ligand) as highly expressed in several cancer types, including breast cancer and lung carcinomas, while being minimally expressed in normal tissues.

  • Engineering approach: Since activated T cells typically express low levels of CCR10, genetic engineering using viral vectors (particularly lentiviral vectors) can be employed to overexpress CCR10 in therapeutic T cells. This approach provides more stable, long-term expression compared to transient methods like mRNA electroporation.

  • Functional improvements: CCR10-engineered T cells demonstrate significantly enhanced migration toward CCL28 gradients. In experimental models, even 25% CCR10 receptor expression resulted in approximately 3.8-4.4 times higher chemotaxis index when exposed to human recombinant CCL28.

  • Integration with other therapeutic modalities: CCR10 can be co-expressed with tumor-targeting receptors (such as TCRs or CARs) to create dual-function therapeutic cells that both recognize tumor antigens and migrate efficiently to tumor sites.

This approach addresses one of the major challenges in solid tumor immunotherapy: insufficient trafficking of therapeutic cells to tumor sites .

What role does CCR10 play in inflammation-driven hepatocarcinogenesis, and how might this inform cancer research?

Research has uncovered significant connections between CCR10 and inflammation-driven hepatocellular carcinoma (HCC):

  • Upregulation in inflammatory contexts: CCR10 is significantly upregulated in hepatocytes isolated from inflammation-driven human HCC tumors and matching paracancerous tissues. This upregulation is also observed in experimental models of inflammatory hepatocarcinogenesis using tetrachloromethane (CCl4) or diethylnitrosamine (DEN).

  • Signaling pathway: TNF stimulation increases CCR10 expression in hepatocytes, leading to enhanced Akt phosphorylation, PCNA expression, and hepatocellular proliferation. Importantly, TNF also increases secretion of CCL28, the natural CCR10 ligand-agonist, creating a potential autocrine/paracrine signaling loop.

  • Functional impact: CCR10 knockout in DEN-treated mice significantly increases hepatocellular apoptosis and reduces compensatory proliferation, resulting in lower liver tumor incidence and smaller tumors. Mechanistically, this occurs through modulation of Akt phosphorylation pathways.

These findings suggest CCR10 as a potential therapeutic target in inflammation-associated liver cancers, with CCR10 antagonists potentially serving as adjuvant treatments. The research also highlights the value of studying chemokine receptors in non-immune cells within the tumor microenvironment .

How can reporter mouse models advance our understanding of chemokine receptor expression dynamics?

Innovative reporter mouse models, such as the inflammatory chemokine receptor reporter (iCCR-REP) mice, represent a transformational advance in studying chemokine receptor biology:

  • Simultaneous tracking of multiple receptors: These models express spectrally distinct fluorescent reporters for multiple chemokine receptors (e.g., CCR1, CCR2, CCR3, and CCR5) within a single animal. The reporters used (mTagBFP2, Clover, mRuby2, and iRFP682) have discrete excitation and emission spectra, allowing clear discrimination.

  • Advantages over antibody-based detection:

    • Reporter expression remains detectable after enzymatic tissue digestion, which often cleaves receptor extracellular domains

    • Eliminates background non-specific staining issues seen with antibodies due to homology between different chemokine receptors

    • Enables detection of receptors for which reliable antibodies are unavailable

  • Application to complex biological questions: These models have revealed that chemokine receptor expression is highly specific and more selective than previously anticipated, challenging the notion of redundancy in the chemokine system.

  • Experimental design opportunities: Researchers can now analyze individual and combinatorial receptor expression patterns on myeloid cells in both resting and inflamed conditions, offering unprecedented insights into the spatial and temporal dynamics of receptor expression.

These models can address fundamental questions about how chemokines orchestrate inflammatory responses and may help identify more precise therapeutic targets in inflammatory diseases .

What are the common challenges in detecting native CCR10 expression, and how can they be overcome?

Researchers frequently encounter several challenges when detecting native CCR10 expression:

  • Low baseline expression: CCR10 is often expressed at low levels in resting cells, making detection difficult.

    • Solution: Use more sensitive detection methods such as qRT-PCR or RNAscope for mRNA detection, or high-sensitivity flow cytometry with signal amplification.

  • Receptor internalization: Chemokine receptors rapidly internalize upon ligand binding, potentially giving false negative results.

    • Solution: Ensure cells are not exposed to ligands before staining, and consider using intracellular staining protocols to detect internalized receptors.

  • Poor antibody specificity: Commercial antibodies may show cross-reactivity with other chemokine receptors due to homology.

    • Solution: Always include appropriate negative controls (ideally cells from CCR10-knockout mice) to establish specific staining. Consider using reporter mice or reporter-tagged constructs when available .

  • Enzymatic digestion artifacts: Tissue digestion protocols commonly cleave the extracellular portions of chemokine receptors.

    • Solution: Optimize tissue digestion protocols to minimize receptor damage, or utilize genetic reporter systems that are unaffected by extracellular proteolysis .

  • Dynamic regulation: CCR10 expression varies with activation state and differentiation.

    • Solution: Carefully time experiments and perform kinetic analyses rather than single time-point measurements .

What are the best practices for reconstituting and handling recombinant mouse CCR10 protein?

Optimal handling of recombinant mouse CCR10 protein requires attention to several factors:

  • Reconstitution protocols:

    • For lyophilized preparations with carrier protein (BSA): Reconstitute at 25 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin.

    • For carrier-free (CF) preparations: Reconstitute at 100 μg/mL in sterile PBS.

  • Storage conditions:

    • Store reconstituted protein at -20°C to -80°C in single-use aliquots.

    • Use a manual defrost freezer and avoid repeated freeze-thaw cycles, which significantly decrease protein activity.

    • For short-term use (less than 1 week), store at 2-8°C.

  • Working solution preparation:

    • Dilute in buffers containing carrier protein (0.1-1% BSA or serum) to prevent adhesion to tubes and loss of activity.

    • For cell culture applications, ensure sterile filtration after dilution.

  • Stability considerations:

    • CCR10 is relatively unstable compared to many other proteins; activity may decline even with proper storage.

    • Consider including protease inhibitors in working solutions to prevent degradation.

    • Always perform functional validation (e.g., chemotaxis assays) before critical experiments .

How can contradictory findings in CCR10 research be reconciled and addressed methodologically?

Contradictory findings in CCR10 research can arise from multiple sources and require systematic approaches to resolve:

When addressing contradictions specifically for CCR10, it's important to recognize that its functions are often context-dependent. For example, the apparently normal intestinal IgA levels in CCR10-knockout mice under homeostatic conditions (which contradicted expected results) were later explained by identifying compensatory mechanisms involving enhanced generation of IgA+ cells in isolated lymphoid follicles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.