Recombinant Mouse C-C chemokine receptor type 1 (Ccr1)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

The production of Recombinant Mouse Ccr1 involves a systematic biotechnological approach. Initially, the mouse Ccr1 protein-encoding gene (1-355 amino acids) is linked to an N-terminal 10×His tag gene to create the target construct. This target gene is then amplified using PCR and cloned into expression vectors, creating recombinant plasmids . Following successful cloning, these plasmids are transfected into an in vitro Escherichia coli expression system, where target proteins are induced during culture .

The expressed proteins are subsequently harvested from the culture supernatant and purified using affinity chromatography, taking advantage of the His-tag's metal-binding properties. This purification process consistently yields recombinant mouse Ccr1 protein with purity exceeding 85%, as validated by SDS-PAGE analysis . The resulting purified protein maintains biological activity and is suitable for various experimental applications, including structural studies, functional assays, and immunological investigations.

Molecular Characterization of Recombinant Mouse Ccr1

Table 1: Characteristics of Recombinant Mouse Ccr1 Protein

ParameterSpecificationSource
Amino Acid Range1 to 355 aa
Expression SystemEscherichia coli
Purity>85%
TagN-terminal His tag
FamilyG-protein coupled receptor 1 family
ApplicationsSDS-PAGE, functional studies
Post-purification AnalysisSDS-PAGE validation

These specifications ensure that the recombinant protein closely resembles the native Ccr1 in structure while incorporating features that facilitate its experimental manipulation and analysis. The high purity level (>85%) is particularly important for ensuring that experimental results reflect the genuine properties of Ccr1 rather than contaminants .

Ligand Interactions and Binding Properties

Ccr1 interacts with multiple chemokine ligands, each triggering specific cellular responses. These interactions are central to the receptor's biological functions, particularly in immune cell recruitment and migration. The following table highlights the key ligands of Mouse Ccr1 and their associated functions:

Table 2: Key Ligands of Mouse Ccr1 and Their Functions

LigandPrimary FunctionCellular ResponseReference
CCL3 (MIP-1α)Immune cell recruitmentNeutrophil migration, TNF-alpha release
CCL5NeuroinflammationERK1/2 pathway activation
CCL6-9Inflammatory responseImmune cell recruitment
CCL13-16Inflammatory responseImmune cell recruitment
CCL23Inflammatory responseImmune cell recruitment
CXCL4Monocyte migrationDirected cell movement

When activated by these ligands, Ccr1 triggers a signaling cascade within immune cells, leading to their migration towards the source of the chemokine . For example, binding of CCL3 to Ccr1 mediates neutrophil migration and leads to the sequential release of TNF-alpha and leukotriene B4, important inflammatory mediators . Similarly, activation by CCL5 results in neuroinflammation through the ERK1/2 signaling pathway .

Role in Immune Cell Migration and Recruitment

Ccr1 plays a crucial role in regulating immune cell migration, inflammation, and immune responses . It contributes significantly to the inflammatory response by recruiting various immune cells, including monocytes, macrophages, T-cells, and dendritic cells, to sites of inflammation for the clearance of pathogens and the resolution of tissue damage .

Studies using Ccr1-deficient mice have demonstrated that this receptor is particularly important for neutrophil chemotaxis. In these knockout models, neutrophils failed to chemotax in vitro and failed to mobilize into peripheral blood in vivo when stimulated with MIP-1α . This defect in neutrophil trafficking has significant implications for host defense against certain pathogens, particularly those controlled by neutrophil-mediated immunity.

The receptor is constitutively expressed in multiple immune cell types, including neutrophils, monocytes, eosinophils, and both T and B lymphocytes . This widespread expression across different leukocyte populations underscores Ccr1's fundamental importance in coordinating immune responses and highlights its potential as a therapeutic target in various inflammatory and immune-mediated conditions.

Involvement in Neuroinflammation

Recent research has highlighted the significant role of Ccr1 in neuroinflammation processes. The receptor is expressed in various cell types within the central nervous system (CNS), including microglia and astrocytes, and has been implicated in the disruption of the blood-brain barrier (BBB) during neuroinflammatory diseases .

Activation of Ccr1 in the central nervous system can lead to increased neuroinflammation, which is associated with conditions such as cerebral hemorrhage and multiple sclerosis . Studies have demonstrated that Ccr1 activation promotes neuroinflammation specifically through the ERK1/2 signaling pathway . This mechanistic understanding provides potential targets for therapeutic intervention in neurological disorders with an inflammatory component.

The involvement of Ccr1 in neuroinflammation represents an important area for future research, particularly regarding the development of targeted therapies for neurological disorders. Modulating Ccr1 activity could potentially help manage the inflammatory component of various CNS diseases, improving outcomes for patients affected by these conditions.

Development and General Characteristics

Studies using Ccr1-deficient mice have provided valuable insights into the non-redundant functions of this receptor in vivo. These knockout mice were generated through targeted gene disruption, replacing a 352-bp fragment of the Ccr1 open reading frame with a neomycin resistance cassette . The resulting mice lack functional Ccr1 but appear phenotypically normal when raised in specific pathogen-free environments.

Ccr1-deficient mice are viable and fertile, exhibiting normal growth, development, anatomy, and behavior compared to wild-type littermates . They have been observed for up to 20 months of age without displaying defects in hemostasis or wound healing, or increased susceptibility to spontaneous infection under standard laboratory conditions .

Histological examination of bone marrow, lymph node, spleen, and thymus revealed no significant differences between Ccr1-deficient mice and wild-type littermates . Similarly, complete blood count and differential analyses showed normal distribution of mature leukocytes. This suggests that while Ccr1 plays important roles in immune function, its absence does not significantly affect basic physiological processes under normal conditions.

Immune Function and Response to Challenges

Despite appearing normal under standard conditions, Ccr1-deficient mice exhibit significant functional deficits when challenged. The following table summarizes the key phenotypic characteristics observed in these knockout models:

Table 3: Phenotypic Characteristics of Ccr1-Deficient Mice

ParameterObservation in Ccr1-Deficient MiceReference
Development and ViabilityNormal development, growth, and fertility
Baseline Leukocyte DistributionNormal histology and cell counts in bone marrow, lymph nodes, spleen, and blood
Neutrophil ChemotaxisFailed response to MIP-1α in vitro
Neutrophil MobilizationFailed mobilization into peripheral blood in response to MIP-1α
Myeloid Progenitor CellsDecreased numbers of CFU-GM and CFU-GEMM in spleen and blood
Antifungal DefenseAccelerated mortality when challenged with Aspergillus fumigatus
Granuloma Formation40% reduction in size of lung granulomas in response to Schistosoma mansoni eggs
Cytokine ProductionIncreased interferon-γ and decreased interleukin-4 in lung lymph node cells

One of the most notable phenotypic features is the impaired neutrophil function. Neutrophils from Ccr1-deficient mice fail to chemotax in vitro and fail to mobilize into peripheral blood in vivo in response to MIP-1α . Consistent with this defect, Ccr1-deficient mice exhibited accelerated mortality when challenged with Aspergillus fumigatus, a fungus controlled primarily by neutrophil-mediated immunity .

These findings highlight the non-redundant role of Ccr1 in neutrophil function and host defense against certain pathogens, particularly those requiring effective neutrophil recruitment and activation for their clearance.

Infection and Host Defense

The importance of Ccr1 in host defense is particularly evident in models of fungal infection. Ccr1-deficient mice showed accelerated mortality when challenged with Aspergillus fumigatus, demonstrating the receptor's crucial role in antifungal defense . This susceptibility is likely due to the impaired neutrophil chemotaxis and mobilization observed in these animals, as neutrophils are primary effectors in controlling fungal infections.

The phenotype of Ccr1-deficient mice is analogous to that previously described for MIP-1α-deficient mice, which also appear phenotypically normal under standard conditions but exhibit impaired inflammatory responses to microbial challenges, including Coxsackie B and influenza viruses . This parallel suggests a critical interaction between MIP-1α and Ccr1 in orchestrating effective antimicrobial immune responses.

These findings have significant implications for understanding host defense mechanisms and potential immunodeficiencies associated with Ccr1 dysfunction. They also highlight the potential risks of therapeutic interventions targeting Ccr1, as inhibition of this receptor might compromise host defense against certain pathogens.

Inflammatory Responses and Granuloma Formation

Ccr1 plays a significant role in inflammatory processes, particularly in granulomatous inflammation. In a model using Schistosoma mansoni eggs, Ccr1-deficient mice exhibited a 40% reduction in the size of lung granulomas compared to wild-type littermates . This reduction in granuloma size demonstrates the important contribution of Ccr1 to the development and maintenance of inflammatory lesions.

Ccr1 deficiency was also associated with altered cytokine production. In the granuloma model, lung lymph node cells from Ccr1-deficient mice produced increased levels of interferon-γ and decreased levels of interleukin-4 when stimulated with egg-specific antigen . This shift suggests that Ccr1 influences the inflammatory response not only through direct effects on leukocyte chemotaxis but also by modulating the balance between type 1 and type 2 cytokine responses.

Hematopoiesis and Progenitor Cell Trafficking

Ccr1 and its ligands, particularly MIP-1α, have been implicated in the regulation of myeloid stem and progenitor cell proliferation and mobilization . Studies with Ccr1-deficient mice have revealed specific defects in the trafficking and proliferation of myeloid progenitor cells both under steady-state conditions and following stimulation.

While there were no differences in the absolute numbers of progenitors per femur between Ccr1-deficient and wild-type mice, significantly decreased numbers of granulocyte-macrophage colony-forming units (CFU-GM) and granulocyte, erythrocyte, macrophage, megakaryocyte colony-forming units (CFU-GEMM) were observed in the spleen and circulating blood of Ccr1-deficient mice . This finding suggests that Ccr1 is involved in the mobilization of progenitor cells from the bone marrow to peripheral sites and their subsequent proliferation, particularly in the spleen.

These observations indicate an important role for Ccr1 in hematopoiesis, specifically in the trafficking and distribution of myeloid progenitor cells. This function could have implications for understanding disorders of hematopoiesis and for developing strategies to enhance hematopoietic recovery following chemotherapy or radiation therapy.

Potential Applications in Inflammatory Disorders

The involvement of Ccr1 in various inflammatory processes suggests potential therapeutic applications for Ccr1 modulators. The reduced granuloma formation observed in Ccr1-deficient mice indicates that Ccr1 antagonists might be effective in treating granulomatous diseases . Similarly, given the role of Ccr1 in neuroinflammation, modulating its activity could potentially benefit patients with neurological disorders that have an inflammatory component, such as multiple sclerosis .

Interestingly, humans homozygous for inactivating mutations in other chemokine receptor genes, such as CCR5 and Duffy, have been identified and do not exhibit obvious health problems . In fact, these individuals appear to be resistant to certain infectious diseases, specifically HIV-1 in the case of CCR5 deficiency and malaria in the case of Duffy deficiency . This suggests that targeting chemokine receptors, including potentially Ccr1, might offer therapeutic benefits with acceptable safety profiles in humans.

Research Challenges and Future Directions

Several challenges and opportunities exist for future research on Recombinant Mouse Ccr1. High-resolution structural studies using techniques such as cryo-electron microscopy could provide valuable insights for the rational design of selective Ccr1 modulators. Additionally, the development of cell-specific or tissue-specific Ccr1 knockout models would help dissect the contribution of Ccr1 expressed by different cell types to various physiological and pathological processes.

Translational studies are needed to determine whether findings from mouse models can be extrapolated to human physiology and pathology. Comparative studies of mouse and human Ccr1, including their expression patterns, ligand specificities, and signaling properties, would be valuable for assessing the potential of Ccr1-targeted therapies in human diseases.

The development and preclinical evaluation of selective Ccr1 modulators, including both antagonists and potentially agonists for specific applications, represents an important step toward translating the basic scientific understanding of Ccr1 biology into clinical applications that could benefit patients with inflammatory, immune-mediated, and perhaps even certain infectious diseases.

Product Specs

Buffer
For liquid formulations, the storage buffer is Tris/PBS-based, containing 5-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer containing 6% Trehalose before lyophilization.
Form
Available in liquid or lyophilized powder formats.
Note: We will prioritize shipment of the currently available format. Should you require a specific format, please indicate this in your order remarks, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
N-terminal 10xHis-tag.
Datasheet & Coa
Please contact us to get it.
Expression Region
1-355aa
Mol. Weight
43.7 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

Function: Recombinant Mouse C-C chemokine receptor type 1 (CCR1) is a receptor for C-C type chemokines. It binds to MIP-1α, RANTES, and, with lower affinity, to MIP-1β and MCP-1. Binding triggers intracellular signaling, increasing intracellular calcium ion levels. CCR1 is also implicated in regulating stem cell proliferation.

Gene References Into Functions

References Supporting Function:

  1. CCL9 secreted by splenic macrophages induces a CCR1-dependent accumulation of MDSCs. PMID: 30365155
  2. The increased presence of CCL3 explains the immediate analgesic effects (independent of anti-inflammatory action) of the CCR1 antagonist J113863 in carrageenan- and complete Freund's adjuvant-inflamed mice. PMID: 26663750
  3. Inhibition of CCR1 may offer therapeutic benefits in metastatic disease with reduced toxicity compared to blocking upstream targets. PMID: 26122939
  4. Inhibition or deletion of CCR1 reduces pain responses. PMID: 25170619
  5. CCR1-mediated myeloid cell accumulation in the liver promotes mouse colon cancer metastasis. PMID: 25326065
  6. CCR1 is required for neutrophil recruitment during respiratory infection with modified vaccinia virus Ankara. PMID: 25008920
  7. A Tpl2-dependent mechanism regulates macrophage expression of select chemokine receptors, including CCR1. PMID: 24713702
  8. CCR1 is critical for T and mononuclear phagocyte cell recruitment to inflamed kidneys in NZB/W mice, contributing to renal injury progression. PMID: 24367031
  9. The CCR1-β-arrestin-2 complex may be involved in a receptor scavenging function, potentially regulating chemokine gradients and receptor responsiveness during inflammation. PMID: 24056371
  10. CCR1 expression in hematopoietic and non-hematopoietic cells promotes tumor aggressiveness and liver cancer metastasis. PMID: 23730212
  11. CCR1 is essential for bone remodeling induced by mechanical loading during orthodontic tooth movement, partly through CCL3. PMID: 23059626
  12. Neutrophil CCR1 amplifies late renal immunopathology and increases mortality in invasive candidiasis by mediating excessive neutrophil recruitment. PMID: 22916017
  13. The bis-quinoline compound RE-660 exhibits CCR1-agonistic properties. PMID: 22104149
  14. CCR1 functions redundantly with CCR5 in the glioblastoma microenvironment. PMID: 22425022
  15. The CCL3-CCR1 interaction is crucial for radiation-induced lung inflammation and fibrosis, preventable by CCR1 inhibitors. PMID: 20870892
  16. CCR1, CCR2, and CCR4 are involved in experimental dengue infection pathogenesis in mice. PMID: 21206747
  17. CCR1 plays a key role in smoke-induced inflammation. PMID: 20387089
  18. Spinal MIP-1α and CCR1 upregulation contributes to neuropathic pain after peripheral nerve injury. PMID: 20692319
  19. The CCR1-ligand axis modulates osteoclast-osteoblast interaction via RANK-RANKL. PMID: 20571024
  20. Ccr1, Mmp2, or Mmp9 gene deletion suppresses liver metastasis. PMID: 20616008
  21. CCR1 overexpression enhances mesenchymal stem cell survival, migration, and engraftment in ischemic myocardium. PMID: 20378860
  22. Mast cells exhibit directional mediator release upon co-stimulation of FcepsilonRI and CCR1. PMID: 20173038
  23. CCL9 and CCR1 are expressed by macrophages, microglia, and potentially play roles in both physiological and pathological conditions. PMID: 19883904
  24. CCL9 and its receptor CCR1 are major chemokine and receptor species expressed by osteoclasts. PMID: 12397598
  25. CCR1 exacerbates *L. major* infection by upregulating Th2-like responses. PMID: 12631234
  26. CCR1 signaling is critical in IL-13-induced pulmonary inflammation. PMID: 14734772
  27. CCR1 plays a significant role in chronic heart graft rejection. PMID: 14757698
  28. Ccr1 is essential for effective antiviral response to systemic HSV-2 infection. PMID: 15030585
  29. CCR1 contributes to the progression of experimental lupus nephritis. PMID: 15153561
  30. CCR1 chemokines stimulate osteoclast recruitment and RANKL formation, potentially impacting skeletal diseases. PMID: 15537451
  31. While not essential for leukocyte recruitment during sepsis, CCR1 triggers proinflammatory cytokine expression, increasing injury and mortality. PMID: 15557190
  32. CCR1-mediated macrophage recruitment contributes to disease progression in COL4A3-deficient mice, suggesting it as a therapeutic target for Alport disease. PMID: 15716328
  33. MIP-1α (CCL3), acting through CCR1, induces TNF-α and LTB4 release in immune inflammation. PMID: 15831559
  34. Rac activation is crucial for CCR1- and CCR5-mediated signaling in beta-chemokine-induced actin cytoskeleton reorganization. PMID: 15882964
  35. CCR1 blockade improves injury in progressive kidney disease, even in advanced stages. PMID: 16088077
  36. The CCR1-CCL3 axis contributes to hepatocellular carcinoma progression. PMID: 16284949
  37. CCR1 signaling is regulated by NFAT2 and enhances osteoclast migration. PMID: 16355273
  38. CCR1 may be a therapeutic target for detrimental pulmonary responses during infection. PMID: 16456018
  39. CCR1 deficiency increases interferon-γ in atherosclerosis, reducing macrophage recruitment. PMID: 16467202
  40. CCR1 blockade alters the immuno-inflammatory response in atherosclerosis, preventing plaque growth and inflammation. PMID: 16491201
  41. Analysis of CCR1 structure and BX 471 antagonist binding. PMID: 16837468
  42. CCR1 plays a role in multiple myeloma osteolysis and angiogenesis, affecting both myeloma and stromal cells. PMID: 17086356
  43. CCR1 deficiency reduces tumor invasion by preventing CD34(+) iMC accumulation. PMID: 17369830
  44. Substance P upregulates neutrophil CCR1 via the neurokinin-1 receptor and NF-κB. PMID: 17494633
  45. CCR1/CCL5 interactions modulate allo-specific T-cell responses. PMID: 17641205
  46. CCR1 deficiency reduces inflammatory remodeling and preserves left ventricular function after myocardial infarction. PMID: 18088392
  47. CCR1 deficiency does not affect mortality during acute murine hepatitis virus (MHV) infection. PMID: 18158733
  48. CCR1 is a potential target for reducing T-cell accumulation in asthma exacerbations. PMID: 18202190
  49. CCR1 and CCR5, and their ligand CCL3, regulate intratumoral dendritic cell accumulation and tumor immunity after apoptosis induction. PMID: 18644849
  50. In renal ischemia-reperfusion injury, CCR1 promotes neutrophil and macrophage infiltration without affecting tissue injury. PMID: 19050287
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in the heart, spleen, lung, peritoneal exudate cells and leukocytes.

Q&A

Basic Research Questions

  • What is mouse Ccr1 and how is it organized in the genome?

    Mouse Ccr1 is a G protein-coupled receptor (GPCR) that plays a significant role in immune responses and inflammation. It is located on mouse chromosome 9, specifically in region 9qF4, flanked by Ccr1l1 and Ccr3. The chromosomal arrangement is part of a cluster containing seven other CC chemokine receptors (Ccr2, Ccr3, Ccr4, Ccr5, Ccr8, and Ccr9). The Ccr1 and Ccr1l1 genes are separated by approximately 14 kb and share the same transcription orientation .

    Mouse Ccr1 protein consists of 355 amino acids with a 7-transmembrane structure typical of GPCRs. It contains a 34 amino acid N-terminal extracellular domain and a 50 amino acid C-terminal cytoplasmic tail . The protein exhibits the characteristic topology of GPCRs with an extracellular N terminus and an intracellular C terminus .

  • What cell types express Ccr1 in mice?

    Mouse Ccr1 is expressed on multiple immune cell types including:

    • Osteoclasts

    • IL-13+ T cells

    • Neutrophils

    • Bone marrow-derived mast cells

    • Eosinophils

    • Monocytes

    • Vascular intimal smooth muscle cells

    Additionally, in the context of neuroinflammation, Ccr1 is expressed in central nervous system cells including microglia and astrocytes .

    Expression levels vary based on inflammatory state, with upregulation often occurring during inflammatory responses .

  • What are the known ligands for mouse Ccr1?

    The primary natural ligands for mouse Ccr1 include:

    LigandStatusNotes
    CCL3/MIP-1αNatural ligandWell-established primary ligand
    CCL5/RANTESNatural ligandWell-established primary ligand
    CCL9/10AgonistPotent after N-terminal processing
    CCL15AgonistPotent after N-terminal processing
    CCL23AgonistPotent after N-terminal processing

    Research has shown that different N-terminal truncations of CCL15 can act as either balanced or biased agonists for Ccr1, which has implications for differential signaling pathway activation .

  • How does mouse Ccr1 compare to related chemokine receptors?

    Mouse Ccr1 shares significant homology with several related chemokine receptors:

    ReceptorAmino Acid Identity with Mouse Ccr1Species
    Ccr1l170%Mouse
    Ccr353%Mouse
    CCR166%Human
    CCR351%Human

    Phylogenetic analysis indicates that Ccr1 shares a common ancestor with Ccr1l1 and Ccr3. Evolutionary data suggests that Ccr1l1 evolved directly from Ccr1 . Unlike Ccr1, which is conserved across mammals, Ccr1l1 is Rodentia-specific and not found in other mammalian families .

Advanced Research Questions

  • What methods are most effective for detecting Ccr1 expression in mouse tissues?

    Several complementary approaches can be used for detecting Ccr1 expression:

    Flow Cytometry:

    • Using fluorescein-conjugated antibodies specific for mouse Ccr1 extracellular regions (aa 1-34, aa 92-107, aa 172-192, aa 265-281)

    • Validated in RAW 264.7 mouse monocyte/macrophage cell lines

    • Critical control: Include isotype control antibodies to distinguish specific from non-specific binding

    RNAscope In Situ Hybridization:

    • Effective for tissue sections to localize Ccr1 mRNA expression

    • Protocol: Fix tissues in 10% Neutral Buffered Formalin, embed in paraffin, and slice into 6 μm sections

    • Use RNAscope target probes specific for Ccr1 with the RNAscope 2.5 HD Reagent Kit-RED

    • Applied successfully in kidney sections with minor modifications to standard protocol (18 min in Target Retrieval Reagent, 35 min with Protease Plus)

    Reporter Mouse Models:

    • iCCR reporter (iCCR-REP) mouse strains expressing spectrally distinct fluorescent reporters

    • For Ccr1, Clover reporter has been used successfully

    Important Methodological Consideration: Commercial antibodies for Ccr1 may show non-specific binding due to high homology between different inflammatory chemokine receptors. Using appropriate Ccr1-/- mice as controls is crucial for validating antibody specificity .

  • What are the considerations when producing recombinant mouse Ccr1 for experimental studies?

    Production of recombinant mouse Ccr1 requires careful attention to several factors:

    Expression Systems:

    • E. coli: Can yield high protein quantities but may lack post-translational modifications

    • Mammalian cells (e.g., HEK293): Provide proper folding and post-translational modifications

    Expression Strategy Example:

    • Clone the mouse Ccr1 protein-encoding gene (1-355aa) with an N-terminal tag (e.g., 10xHis tag)

    • Amplify by PCR and clone into appropriate expression vectors

    • Express in E. coli or mammalian expression systems

    • Purify using affinity chromatography to achieve >85% purity

    Tagging Approaches:

    • C-terminal HA-tag (pNT1 construct)

    • N-terminal HA-tag (pNT2 construct)

    • Both constructs successfully express Ccr1 on the plasma membrane of transfected cells

    • Myc-tagged Ccr1 (myc-Ccr1) has been successfully used in L1.2 cell lines for internalization studies

    Validation Methods:

    • SDS-PAGE to confirm purity and molecular weight

    • Surface expression confirmation through immunostaining

    • Functional validation through ligand binding, receptor internalization, and signaling assays

  • How can researchers investigate Ccr1 signaling pathways and functional responses?

    To study Ccr1 signaling and functional responses, researchers can employ multiple complementary assays:

    Receptor Internalization Assays:

    • Generate stable cell lines expressing tagged Ccr1 (e.g., myc-Ccr1 in L1.2 cells)

    • Expose cells to potential ligands and measure receptor internalization via flow cytometry

    • L1.2 cells are ideal for chemokine-mediated responses and have been successfully used for deorphanizing chemokine receptors

    β-arrestin Recruitment Assays:

    • Measure β-arrestin-2 recruitment following receptor activation

    • Can be assessed using bioluminescence resonance energy transfer (BRET) technology

    • Useful for both constitutive activity assessment and ligand-induced activation

    Calcium Flux Measurements:

    • Load cells with calcium-sensitive dyes

    • Measure intracellular calcium mobilization following receptor activation

    • Useful for rapid signaling responses assessment

    cAMP Formation Inhibition:

    • Measure inhibition of forskolin-stimulated cAMP formation

    • Indicates Gαi protein coupling and activation

    Chemotaxis Assays:

    • Transwell migration assays to assess cellular movement toward chemokines

    • Can detect both constitutive activity (basal migration) and ligand-induced migration

    F-actin Measurement:

    • Quantify changes in F-actin content following receptor activation

    • Indicates cytoskeletal reorganization linked to cellular migration

  • What is the significance of Ccr1's constitutive activity and how does it impact experimental design?

    Ccr1 exhibits significant constitutive activity (ligand-independent activity) that must be considered in experimental design:

    Manifestations of Constitutive Activity:

    • Basal inhibition of cAMP formation

    • Increased F-actin content in expressing cells

    • Spontaneous migration of human and murine leukocytes

    • Basal phosphorylation of the receptor

    • Recruitment of β-arrestin-2 without ligand stimulation

    • Receptor internalization in the absence of ligand

    Experimental Design Considerations:

    • Always include appropriate negative controls (cells not expressing Ccr1)

    • Monitor basal activity levels before stimulation with potential ligands

    • Use inverse agonists (compounds that reduce constitutive activity) as controls

    • Consider dual functions: canonical signaling and non-canonical chemokine scavenging

    Functional Implications:

    • Constitutive activity may contribute to β-arrestin-mediated internalization of Ccr1

    • This property distinguishes Ccr1 from other chemokine receptors that show minimal basal activity

    • May explain observed higher basal migration in Ccr1-expressing cells compared to cells expressing other chemokine receptors

  • How can fluorescent ligands be developed for studying Ccr1 binding and activation?

    Development of fluorescent ligands for studying Ccr1 requires strategic design:

    Design Strategy:

    • Start with a known high-affinity Ccr1 ligand scaffold (e.g., pyrrolones)

    • Identify structure-activity relationships to determine optimal attachment points

    • Add an appropriate linker to connect the ligand to the fluorophore

    • Select a fluorophore with suitable spectral properties

    Example of Successful Development:

    • Compound 12 was developed as a fluorescent probe for the intracellular allosteric binding site (IABS) of Ccr1

    • Properties: KD(eq.) = 1.90 ± 0.18 μM; KD(kin.) = 0.317 ± 0.032 μM

    • Enabled both equilibrium and kinetic binding studies

    Validation Methods:

    • Verify retained binding affinity through competition with known ligands

    • Measure kinetic binding parameters (kon, koff, residence time)

    • Example results for established ligands:

      • Compound 5: pKi = 7.96 ± 0.10 (11.8 nM)

      • Compound 4: pKi = 7.35 ± 0.04 (44.5 nM)

    Applications:

    • Cell-free NanoBRET-based assays for detailed binding studies

    • Live cell imaging to track receptor localization and trafficking

    • High-throughput screening of potential new Ccr1 ligands

  • How can Ccr1 knockout or reporter mouse models be utilized in inflammatory disease research?

    Mouse models provide powerful tools for studying Ccr1 function in disease contexts:

    Ccr1 Knockout Models:

    • Allow assessment of Ccr1's role in various inflammatory conditions

    • Used successfully in transplantation studies where Ccr1-/- mice showed prolonged allograft survival

    • Enable phenotyping of specific cell populations in the absence of Ccr1 signaling

    • Can reveal compensatory mechanisms by related chemokine receptors

    iCCR Reporter Mouse Models:

    • iCCR-REP mice express spectrally distinct fluorescent reporters for multiple chemokine receptors

    • For Ccr1, the Clover fluorescent protein has been used

    • Generated using bacterial artificial chromosome (BAC) technology

    • Allow simultaneous tracking of multiple chemokine receptors (Ccr1, Ccr2, Ccr3, Ccr5)

    Generation of iCCR-REP Mice:

    1. Recombineering of BAC encompassing the inflammatory Ccr gene cluster

    2. Replacement of Ccr1 coding sequence with Clover sequence

    3. Pro-nuclear injection of the modified BAC

    4. Validation via PCR using primers specific for iCCR reporters

    5. Quantification of copy numbers using qPCR with TBP gene as reference

    Applications in Disease Models:

    • Tracking Ccr1 expression dynamics during inflammatory responses

    • Flow cytometric analysis of Ccr1+ cells in various tissues

    • Imaging-based analysis of Ccr1 expression in tissue sections

    • Studying the role of Ccr1 in specific pathological contexts such as:

      • Neuroinflammation and intracerebral hemorrhage

      • Organ transplant rejection

      • Recruitment of immune cells to inflammatory sites

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.