Recombinant Mouse C-C chemokine receptor type 4 (Ccr4)

Shipped with Ice Packs
In Stock

Description

Biological Functions

CCR4 plays pivotal roles in immune regulation and disease:

  • Immune Cell Trafficking: Binds CCL17 (TARC) and CCL22 (MDC), directing Th2 cells, regulatory T cells (Tregs), and dendritic cells to inflammatory sites .

  • Neuroinflammation: Mediates hippocampal neuron survival and neuropathic pain via interactions with microglia .

  • Atherosclerosis: CCR4 deficiency in mice exacerbates early atherosclerotic lesions by skewing Treg/Th1 balance .

Functional Comparison in Disease Models:

ConditionCCR4 RoleKey Findings
Neuropathic painPromotes hypersensitivityCCR4 antagonist (C021) reduces tactile/thermal pain in mice .
AtherosclerosisRegulates Treg-mediated inflammationCCR4-KO mice show increased plaque macrophages and Th1 cells .
Cutaneous T-cell lymphomaTherapeutic targetAnti-CCR4 antibody mogamulizumab is under investigation .

Research Applications

Recombinant mouse CCR4 is utilized in:

  • Binding Assays: Confirms ligand specificity (e.g., CCL17, CCL22) .

  • Chemotaxis Studies: Measures T cell migration in response to chemokines .

  • Western Blot/Immunocytochemistry: Detects CCR4 in lysates (e.g., EL-4 mouse lymphoblast cells) .

Example Experimental Data:

ApplicationMethodResult
Ligand bindingRadiolabeled CCL17K<sub>d</sub> = 0.8 nM for CCR4 .
Chemotaxis assayTranswell migrationCCR4+ T cells show 2.6-fold enrichment in response to MDC .
In vivo functional studyCCR4-KO miceIncreased aortic plaque area (1.5-fold vs. controls) .

Key Research Findings

  • T Cell Polarization: CCR4 is upregulated on Th2 cells during IL-4-driven differentiation but absent in Th1 cells .

  • Therapeutic Targeting:

    • C021 (CCR4 antagonist) enhances morphine/buprenorphine efficacy in neuropathic pain models .

    • CCR4 blockade reduces microglial activation and CCL2 production in spinal cord injury .

  • Atherosclerosis Mechanism: CCR4 deficiency disrupts Treg suppression, increasing pro-inflammatory Th1 cells in plaques .

Future Directions

Current research focuses on:

  • CCR4’s role in autoimmune diseases (e.g., multiple sclerosis, asthma).

  • Dual CCR4/CCR8 targeting for enhanced therapeutic efficacy in cancer and chronic inflammation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
Ccr4; Cmkbr4; C-C chemokine receptor type 4; C-C CKR-4; CC-CKR-4; CCR-4; CCR4; CD antigen CD194
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVV VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVG FYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYT EHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRA VRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLN PVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
Uniprot No.

Target Background

Function
CCR4 serves as a high-affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The receptor's activity is mediated by G(i) proteins, which activate a phosphatidylinositol-calcium second messenger system. CCR4 might play a role in lipopolysaccharide (LPS)-induced endotoxic shock. In the central nervous system (CNS), it potentially mediates hippocampal-neuron survival.
Gene References Into Functions
  1. Data demonstrate a mechanistic or developmental role of CCR4 in the regulation of locomotor and exploratory behaviors. PMID: 27469058
  2. A CCR4 antagonist reverses the tumor-promoting microenvironment of renal cancer. PMID: 28134623
  3. CCR4 is critically involved in regional lymph node dendritic cell-Th17 cell interactions that are necessary for Th17 cell-mediated induction of antitumor CD8+ effector T cells in mice bearing B16 melanoma. PMID: 27132989
  4. CCR4 is implicated in immunosuppression after severe sepsis, suggesting that CCR4+ Regulatory T Cells negatively modulate short and long-term immune responses. PMID: 26197455
  5. CCL22 was mainly localized on the cell surface or in the cytoplasm. Within sections of omental milky spot micrometastases, CCR4 was detected on or in gastric cancer cells, constituent cells of milky spots, blood cells, and blood endothelial cells. PMID: 25245466
  6. CCR4 is involved in regulating negative selection of polyclonal and T cell receptor (TCR) transgenic thymocytes. PMID: 26417005
  7. Results indicate that the IL-4/CCL22/CCR4 axis participates in the migration of Tregs to osteolytic lesion sites, attenuating lesion development by inhibiting inflammatory migration and the production of proinflammatory and osteoclastogenic mediators. PMID: 25264308
  8. These data have uncovered a novel role for core components of the Ccr4-Not complex as regulators of the transition from partial to genuine induced pluripotent stem cells. PMID: 24200330
  9. Effective engagement of CCR4 by CCL17 involves two distinct binding domains, and interaction with both is necessary for signaling. PMID: 24339934
  10. The NF-kappaB signaling pathway was implicated in the asthmatic change induced by CKLF1, where CCR4 potentially plays a critical role. PMID: 24583145
  11. CCR4-expressing Th2cells play a crucial role in the pathogenesis of bronchial asthma by producing Th2 cytokines. PMID: 24238232
  12. CCR4 promotes natural killer cell priming/activation by mediating contacts with sentinel cells in the lung. PMID: 24333113
  13. Combining a panel of thymocyte maturation markers with cell surface analysis of CCR7 and CCR4 identifies distinct stages in the development of multiple alphabetaT cell lineages in the adult thymus. PMID: 24990081
  14. Lung dendritic cells imprint T cell lung homing and promote lung immunity, in part through CCR4. PMID: 23960189
  15. CCR4-deficient mice exhibit a more rapid progression of experimental autoimmune encephalomyelitis. PMID: 23477966
  16. Exacerbated allergic inflammation in CCR4KO mice was directly associated with impaired migration of regulatory (Treg) cells to airways and increased frequency of pulmonary T helper (Th)2 cells. PMID: 23390295
  17. CCR4 plays a significant role in T reg cell trafficking in lymph nodes, which is crucial for T reg cell suppressive function in inflammatory bowel disease. PMID: 17548518
  18. CCR4 is not restricted to T helper (Th) type 2 cells and is required for the maintenance and expression of the Th1 effector/memory response to mycobacterial antigens. PMID: 16951380
  19. CC chemokine receptor 4 is required for experimental autoimmune encephalomyelitis by regulating GM-CSF and IL-23 production in dendritic cells. PMID: 22355103
  20. After lentivirus-mediated shRNA treatment of Dox-treated CD200tg mice to attenuate expression of CCR4 mRNA, the increased localization of Treg cells in skin/DLN of CD200tg recipients of skin grafts was abolished. PMID: 21945175
  21. CCR-4 deficiency was characterized by a moderate decrease in the amount of neutrophils sequestered in the lungs. PMID: 21345872
  22. CCR4 regulates experimental autoimmune encephalomyelitis (EAE) development and is involved in inflammatory macrophage effector function during EAE. PMID: 21575994
  23. Data show that the presence of the Ccr4 and Ccl22 transcripts were detected in brain slices. PMID: 21177120
  24. CCR4 appeared to be required for sustaining the local pulmonary memory effector response in the long-term but not the early bacterial elimination stage of Mycobacterium bovis infection. PMID: 21224060
  25. The absence of CCR4 results in enhanced secondary immune response during allergic skin inflammation. PMID: 20631725
  26. Embryonic trafficking of gammadelta T cells to skin is dependent on E/P selectin ligands and CCR4. PMID: 20368416
  27. This research reports an unexpected role for CCR4 and CCL17 in NKT cell-licensed cross-priming. PMID: 20190758
  28. Airway hyperresponsiveness, but not airway remodeling, is attenuated during chronic pulmonary allergic responses to Aspergillus in CCR4-/- mice. PMID: 12154006
  29. T cells bearing this receptor participate in autoimmune diabetes. PMID: 12464673
  30. CLA/E-selectin interactions play a role in CCR4-mediated recruitment of human Th2 memory cells to human skin in vivo. PMID: 12555662
  31. CCR4 has a role in acute and chronic cardiac allograft rejection. PMID: 15593118
  32. CCR4 expression provides a competitive advantage to cutaneous T helper cells, either by participating in their development from naive Th cells, or by preferentially maintaining them within the memory population over time. PMID: 15795234
  33. Recruitment of Foxp3+ T regulatory cells mediating allograft tolerance depends on the CCR4 chemokine receptor. PMID: 15809349
  34. Pulmonary localization of iNKT cells critical for the induction of AHR requires CCR4 expression by iNKT cells. PMID: 17878364
  35. This study provides direct evidence for the presence of CCR4 and its ligands, CCL17 and CCL22, in mouse contact hypersensitivity. PMID: 18052724
  36. CCL17-dependent activation of CCR4 in macrophages plays a central role in free radical-induced pulmonary injury and repair. PMID: 18403600
  37. Macrophages deficient in CCR4 impart a regulatory influence on TLR9-mediated innate immunity. PMID: 18624303
  38. CCR4 plays a strictly detrimental role in the course of polymicrobial sepsis. PMID: 18765730
  39. Contribution of CCR4 and CCR8 to antigen-specific T(H)2 cell trafficking in allergic pulmonary inflammation. PMID: 19062085

Show More

Hide All

Database Links

KEGG: mmu:12773

STRING: 10090.ENSMUSP00000062677

UniGene: Mm.1337

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the thymus, macrophages and T- and B-cells.

Q&A

What is C-C chemokine receptor type 4 (CCR4) and what are its primary functions in mouse models?

CCR4 is a seven-transmembrane G protein-coupled receptor that serves as a key regulator of T cell trafficking and immune responses. In mice, CCR4 functions primarily as a receptor for the chemokines CCL17 (TARC) and CCL22 (MDC), mediating the migration of various T cell subsets to sites of inflammation.

CCR4 has been identified as a marker for several T cell populations, including T helper type 2 (Th2) cells and T helper type 17 (Th17) cells . It plays a critical role in regulating the balance between proinflammatory T cells and anti-inflammatory regulatory T cells (Tregs) . Recent studies have demonstrated that CCR4 deficiency in mouse models leads to exacerbated inflammation in various disease models, highlighting its importance in immune homeostasis.

Methodological approach: To study CCR4 function in mice, researchers typically employ flow cytometry with fluorescently-labeled antibodies to detect receptor expression, chemotaxis assays to evaluate migratory responses, and genetic approaches (knockout or conditional knockout models) to assess the impact of CCR4 deficiency on immune responses in various disease contexts.

Which cell types express CCR4 in mice and how does this expression pattern influence research applications?

In mice, CCR4 exhibits a distinct expression pattern predominantly on lymphoid cells:

  • T helper type 2 (Th2) cells

  • T helper type 17 (Th17) cells

  • Regulatory T cells (Tregs)

  • Memory CD4+ T lymphocytes, particularly skin-homing populations

  • Subset of thymocytes

  • Some dendritic cell populations

While human CCR4 has been extensively characterized, mouse CCR4 shows a similar pattern with "high expression in most single-positive CD4+ thymocytes and on a major fraction of blood memory CD4 lymphocytes, including skin-homing memory cells" .

Methodological approach: Researchers can isolate specific cell populations from mouse lymphoid tissues for functional studies using magnetic bead selection or flow cytometry sorting based on CCR4 expression. Single-cell RNA sequencing provides comprehensive analysis of CCR4 expression across immune cell subsets in different physiological and pathological conditions.

What are the optimal expression systems for producing functional recombinant mouse CCR4?

Producing functional recombinant mouse CCR4 presents significant challenges due to its complex structure as a multi-pass membrane protein. The table below compares different expression systems:

Expression SystemAdvantagesDisadvantagesTypical YieldFunctional Quality
HEK293 cellsNative-like post-translational modifications, proper foldingHigher cost, moderate yield0.5-2 mg/LExcellent
CHO cellsStable expression, scalableTime-consuming development1-5 mg/LVery good
Sf9/Hi5 insect cellsHigher yield, large-scale productionDifferent glycosylation pattern5-10 mg/LGood
Pichia pastorisCost-effective, high density cultureDifferent membrane environment2-8 mg/LModerate
E. coliSimple, inexpensiveInclusion bodies, lack of PTMs>10 mg/LPoor without refolding

Methodological approach: Mammalian expression systems (particularly HEK293 cells) are generally preferred for producing functional mouse CCR4, as they provide the appropriate cellular machinery for proper folding and post-translational modifications. For optimal results, researchers should incorporate purification tags (His, FLAG, or Strep) and consider using tetracycline-inducible expression systems to control expression levels.

How can the purity and functionality of recombinant mouse CCR4 be assessed?

A comprehensive quality assessment protocol for recombinant mouse CCR4 should include both purity and functional analyses:

Purity Assessment:

  • SDS-PAGE with Coomassie or silver staining

  • Western blotting using specific anti-CCR4 antibodies

  • Size exclusion chromatography to evaluate homogeneity

  • Mass spectrometry for precise molecular characterization

Functional Assessment:

  • Ligand binding assays using radiolabeled or fluorescently-labeled CCL17/CCL22

  • Surface plasmon resonance (SPR) to measure binding kinetics and affinity

  • GTPγS binding assays to evaluate G-protein coupling

  • Calcium flux assays in cells expressing recombinant CCR4

  • Chemotaxis assays using transwell systems

Methodological approach: Researchers should establish clear acceptance criteria for both purity (typically >90% by SDS-PAGE) and functionality (ligand binding with Kd values in the nanomolar range). Comparing the properties of recombinant mouse CCR4 with the native receptor expressed in primary mouse T cells provides validation of physiological relevance.

How does CCR4 deficiency impact immune responses in mouse disease models?

CCR4 knockout or deficiency in mice reveals complex and sometimes paradoxical roles in disease pathogenesis:

In atherosclerosis models: "Genetic deletion of CCR4 in hypercholesterolemic mice accelerates the development of early atherosclerotic lesions characterized by an inflammatory plaque phenotype. This was associated with proinflammatory T helper type 1 (Th1) cell-skewed responses in peripheral lymphoid tissues, para-aortic lymph nodes, and atherosclerotic aorta" .

The mechanistic basis for this effect was identified: "CCR4 deficiency in Tregs impaired their suppressive function and migration to the atherosclerotic aorta and augmented Th1 cell-mediated immune responses through defective regulation of dendritic cell function, which accelerated aortic inflammation and atherosclerotic lesion development" .

Additional disease models affected by CCR4 deficiency include:

  • Allergic airway inflammation: Reduced Th2 cell recruitment

  • Atopic dermatitis: Decreased skin inflammation

  • Autoimmune disorders: Variable effects depending on the relative importance of effector vs. regulatory T cells

  • Tumor immunity: Enhanced anti-tumor responses in some models

Methodological approach: When studying CCR4-deficient mice, researchers should comprehensively analyze immune cell populations using flow cytometry, measure tissue-specific cytokine profiles, and evaluate cell migration patterns using adoptive transfer of labeled cells or intravital microscopy.

What molecular techniques can be used to study CCR4 signaling pathways in mouse cells?

CCR4 signaling can be investigated using various complementary techniques:

Calcium Mobilization Assays:

  • Fura-2 or Fluo-4 loading for ratiometric or single-wavelength detection

  • Real-time kinetic measurements in primary mouse T cells or cell lines

  • Comparison of CCR4 wild-type vs. mutant receptor signaling

Phosphorylation Analysis:

  • Western blotting for downstream signaling molecules (ERK1/2, AKT, p38)

  • Phospho-flow cytometry for single-cell resolution

  • Phosphoproteomic analysis for comprehensive pathway mapping

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation of CCR4 with G proteins or β-arrestins

  • BRET/FRET assays for real-time interaction monitoring

  • Proximity ligation assays in fixed cells or tissues

Gene Expression Analysis:

  • RNA-seq following CCR4 activation in different T cell subsets

  • ChIP-seq to identify transcription factors activated downstream of CCR4

  • Single-cell transcriptomics to capture heterogeneity in responses

Methodological approach: For robust signaling studies, researchers should use multiple complementary techniques and include appropriate controls (receptor antagonists, pertussis toxin for Gαi inhibition). Time-course experiments are essential to capture both rapid (seconds to minutes) and delayed (hours) signaling events.

How can CRISPR-Cas9 technology be utilized to study CCR4 function in mouse models?

CRISPR-Cas9 technology offers versatile approaches to interrogate CCR4 biology:

Genome Editing Applications:

  • Generation of complete CCR4 knockout mice

  • Introduction of point mutations to study structure-function relationships

  • Creation of reporter knock-ins (GFP, luciferase) under endogenous control

  • Conditional alleles for tissue-specific or inducible deletion

  • Humanization of mouse CCR4 for translational studies

Similar genome editing approaches have been successfully applied to chemokine receptors: "This study provides an effective approach to create a CXCR4 mutation...without leaving any genetic footprint inside cells" . These techniques can be adapted for CCR4 research.

Methodological approach: For successful CRISPR-Cas9 editing of CCR4, researchers should:

  • Design multiple guide RNAs targeting the desired region

  • Test editing efficiency in mouse cell lines before moving to primary cells or zygotes

  • Include appropriate repair templates for precise mutations or insertions

  • Screen founders using sequencing and functional assays

  • Validate phenotypes across multiple independent lines

What are the challenges in translating findings from recombinant mouse CCR4 studies to in vivo contexts?

Translating findings from recombinant protein studies to physiological contexts presents several challenges:

Technical Challenges:

  • Maintaining native conformation of CCR4 after purification

  • Ensuring appropriate post-translational modifications

  • Recreating the proper membrane environment

  • Accounting for protein-protein interactions absent in purified systems

Biological Considerations:

  • Differences in expression levels between recombinant and endogenous systems

  • Cell type-specific signaling contexts

  • Impact of the inflammatory microenvironment on receptor function

  • Compensatory mechanisms in knockout models

  • Potential differences between acute (antagonist) vs. chronic (genetic) inhibition

Methodological approach: To bridge this translational gap, researchers should:

  • Validate recombinant protein findings in primary mouse cells

  • Compare pharmacological inhibition with genetic approaches

  • Use conditional and inducible knockout models to minimize developmental effects

  • Perform detailed dose-response studies with inhibitors

  • Consider the impact of the microenvironment on receptor function

How does CCR4 participate in T cell differentiation and function in mouse models?

CCR4 plays multifaceted roles in T cell biology beyond simple chemotaxis:

T Cell Differentiation:

  • CCR4 expression is induced during Th2 and Th17 differentiation

  • CCR4 signaling may reinforce lineage commitment

  • CCR4 deficiency can skew responses toward Th1 phenotypes

Regulatory T Cell Function:

  • CCR4 is required for optimal Treg migration to tissues

  • CCR4-deficient Tregs show impaired suppressive function

  • CCR4 contributes to Treg homeostasis in certain tissues

T Cell Activation:

  • CCR4-deficient T cells show altered activation profiles

  • "The expression of activation marker CTLA-4 in peripheral LN CD4+Foxp3− non-Tregs was higher in Ccr4−/−Apoe−/− mice than in Apoe−/− mice"

  • "We found a marked increase in the mRNA expression of activation-associated molecules (Ctla4, Cd44, and Cd103) in splenic non-Tregs from Ccr4−/−Apoe−/− mice"

Cytokine Production:

  • CCR4 deficiency affects cytokine profiles: "Compared with those from Apoe−/− mice, splenic CD4+ T cells from Ccr4−/−Apoe−/− mice secreted more Th1-related cytokine IFN-γ, Th2-related cytokine IL-13, Th17-related cytokine IL-17, and various inflammation-related cytokines and chemokines"

Methodological approach: When studying CCR4's role in T cell function, researchers should isolate defined T cell subsets (naïve, memory, Th1, Th2, Th17, Treg) from wild-type and CCR4-deficient mice and comprehensively analyze their phenotype, migration, proliferation, survival, and effector functions under various stimulation conditions.

What strategies can optimize the solubility and stability of recombinant mouse CCR4?

As a seven-transmembrane protein, CCR4 presents significant challenges for maintaining stability in solution:

Solubilization Strategies:

  • Detergent screening (DDM, LMNG, GDN, and CHAPS often perform well)

  • Lipid nanodiscs for membrane protein stabilization

  • Styrene maleic acid lipid particles (SMALPs) for native-like environment

  • Saposin-lipoprotein nanoparticles as alternative scaffold

Stabilization Approaches:

  • Addition of cholesterol or specific lipids

  • Inclusion of ligands during purification

  • Introduction of thermostabilizing mutations

  • Fusion with soluble partners (T4 lysozyme, BRIL)

Buffer Optimization:

  • pH screening (typically 7.0-8.0)

  • Salt concentration and type

  • Glycerol or sucrose as stabilizing agents

  • Antioxidants to prevent oxidation of cysteine residues

Methodological approach: Researchers should perform systematic stability screening using techniques like differential scanning fluorimetry, size exclusion chromatography, and functional binding assays to identify optimal conditions. Long-term stability should be assessed at different temperatures (4°C, -20°C, -80°C) with regular functional testing.

How can post-translational modifications of mouse CCR4 be characterized and their functional impact assessed?

Post-translational modifications (PTMs) critically impact CCR4 function:

Key CCR4 Post-translational Modifications:

  • N-linked glycosylation: Affects folding and trafficking

  • Tyrosine sulfation: Modulates ligand binding

  • Palmitoylation: Influences receptor stability and localization

  • Phosphorylation: Regulates desensitization and signaling

Analytical Techniques:

  • Mass spectrometry for comprehensive PTM mapping

  • Site-directed mutagenesis to create PTM-deficient variants

  • Glycosidase treatments to assess glycosylation impact

  • Metabolic labeling to study dynamic modifications

Functional Impact Assessment:

  • Ligand binding assays comparing wild-type and PTM-deficient variants

  • Trafficking studies using fluorescence microscopy

  • Signaling assays (calcium flux, ERK phosphorylation)

  • Receptor internalization and recycling kinetics

Methodological approach: Researchers should initially characterize the PTM profile of native mouse CCR4 in primary T cells as a reference, then compare this to recombinant CCR4 produced in different expression systems. Systematic mutation of PTM sites followed by functional testing will reveal their relative importance.

How can recombinant mouse CCR4 facilitate drug discovery targeting chemokine receptors?

Recombinant mouse CCR4 serves as a valuable tool in therapeutic development:

Drug Discovery Applications:

  • High-throughput screening platforms

  • Structure-based drug design

  • Antibody development and characterization

  • Bispecific agent engineering

  • Species cross-reactivity testing

Screening Methodologies:

  • Competitive binding assays

  • Functional antagonism assays (calcium flux, β-arrestin recruitment)

  • Receptor internalization assays

  • Allosteric modulator identification

Translation to Human Applications:

  • Parallel testing on mouse and human CCR4

  • Identification of species-conserved binding pockets

  • Understanding of species-specific signaling differences

  • Development of mouse models for in vivo testing

Methodological approach: Researchers should establish robust cell-based assays with recombinant mouse CCR4, optimize them for high-throughput screening, and include appropriate controls and counter-screens to identify selective compounds. Testing active compounds in both mouse and human systems early in development facilitates later translational studies.

What are emerging technologies that could enhance the study of recombinant mouse CCR4?

Several cutting-edge technologies are transforming CCR4 research:

Structural Biology Approaches:

  • Cryo-electron microscopy for receptor-ligand complexes

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Single-particle tracking for receptor diffusion and clustering

  • Alphascreen/HTRF for protein-protein interaction screening

Genetic Engineering Tools:

  • Base editing for precise single nucleotide modifications

  • Prime editing for targeted insertions and deletions

  • CRISPR activation/interference for endogenous gene regulation

  • Genetic code expansion for site-specific incorporation of modified amino acids

Advanced Imaging Techniques:

  • Super-resolution microscopy for nanoscale receptor organization

  • FRET-based biosensors for signaling visualization

  • Live cell imaging with labeled chemokines

  • Intravital multiphoton microscopy for in vivo migration studies

Methodological approach: When implementing these technologies, researchers should begin with proof-of-concept studies in well-characterized systems before applying them to more complex biological questions. Combining multiple complementary approaches provides the most robust insights into CCR4 biology.

How do mouse CCR4 ligand interactions compare with the human receptor, and what are the implications for translational research?

Understanding species differences is crucial for translational studies:

Ligand Binding Comparisons:

  • Mouse and human CCR4 both bind CCL17 and CCL22

  • Binding affinities may differ between species

  • Subtle differences in binding pocket structure can affect antagonist binding

  • Species-specific post-translational modifications may influence ligand recognition

Signaling Differences:

  • G-protein coupling efficiency may vary between species

  • Biased signaling profiles might differ for the same ligand

  • Receptor internalization and recycling kinetics can vary

  • Differential interactions with regulatory proteins

Translational Implications:

  • Drug candidates should be tested against both mouse and human CCR4

  • Species differences may affect in vivo efficacy predictions

  • Humanized mouse models may be needed for certain studies

  • Careful interpretation of mouse data when extrapolating to humans

Methodological approach: Side-by-side comparative studies using identical experimental conditions for mouse and human CCR4 are essential. This should include detailed pharmacological characterization (binding affinity, potency, efficacy) for both natural ligands and synthetic compounds to identify any species differences that might impact translational research.

What are the most significant unresolved questions in mouse CCR4 research?

Despite significant advances, several key questions remain in CCR4 biology:

Structural Biology:

  • How does CCR4 conformation change upon ligand binding?

  • What is the structural basis for ligand selectivity?

  • How do different intracellular signaling proteins recognize activated CCR4?

Signaling Biology:

  • What determines biased signaling through CCR4?

  • How does the signaling profile differ across T cell subsets?

  • What is the cross-talk between CCR4 and other chemokine receptors?

Therapeutic Applications:

  • Can selective modulation of CCR4 function be achieved without impairing beneficial immune responses?

  • How can CCR4 targeting be applied to inflammatory diseases beyond its current applications?

  • What biomarkers can predict response to CCR4-targeted therapies?

Methodological approach: Addressing these questions requires interdisciplinary approaches combining structural biology, advanced imaging, genetic engineering, and systems biology. Long-term, carefully designed studies in relevant disease models will be particularly important for translating mechanistic insights into therapeutic applications.

How can optimized recombinant mouse CCR4 systems advance understanding of chemokine biology?

Well-characterized recombinant mouse CCR4 systems can drive significant advances:

Benefits for Basic Research:

  • Detailed structure-function studies

  • Precise mapping of ligand binding sites

  • Identification of allosteric modulatory sites

  • Understanding of receptor dynamics and trafficking

Contributions to Systems Biology:

  • Quantitative measurement of binding and signaling parameters

  • Mathematical modeling of chemokine network function

  • Predictive models of cell migration in complex environments

  • Integration of receptor function with broader immune signaling networks

Technology Development:

  • Novel biosensors for CCR4 activation

  • High-throughput screening platforms

  • Development of engineered cells for immunotherapy

  • Creation of modified receptors with novel functions

Methodological approach: To maximize the impact of recombinant CCR4 systems, researchers should focus on creating well-validated, reproducible tools that are accessible to the broader scientific community. This includes detailed protocols for expression and purification, comprehensive characterization data, and availability of key reagents through repositories or commercial sources.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.