Recombinant Mouse C-C chemokine receptor type 5 (Ccr5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any special requirements for the format, please remark your requirement when placing the order, and we will prepare according to your demand.
Lead Time
Delivery time may differ depending on the purchasing method or location. Please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as extra fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ccr5; Cmkbr5C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; MIP-1 alpha receptor; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC KKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFF IILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASLPEIIFTRSQKEGFHYTC SPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIF AIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYA FVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Uniprot No.

Target Background

Function
CCR5 acts as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. Upon binding these chemokines, CCR5 transduces a signal by increasing intracellular calcium ion levels. This receptor may play a role in controlling granulocytic lineage proliferation or differentiation. CCR5 participates in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Gene References Into Functions
  1. Data provides evidence that CCR5 plays a crucial role in bone-destructive conditions through its functional regulation of osteoclasts. PMID: 29263385
  2. Blockade of CCR5-mediated myeloid-derived suppressor cell accumulation enhances anti-PD1 efficacy in gastric cancer. PMID: 29303012
  3. The interaction between CCR5 and its ligands promotes the proliferation of CCR5(+) polymorphonuclear-myeloid-derived suppressor cells in the bone marrow. PMID: 29166611
  4. This study suggests potential neuroprotection in the absence of the CCR5 receptor during global brain ischemia and reperfusion injury. PMID: 28294064
  5. Researchers studied the effects of CCL5-CCR5 interactions in breast cancer metabolism. Findings suggest that CCL5-CCR5 interactions in the tumor microenvironment modulate metabolic events during tumor onset, promoting tumorigenesis. PMID: 29216863
  6. Loss of CCR5 is associated with astrogliosis, amyloid-beta deposit, and impaired memory function. PMID: 26910914
  7. These findings suggest that CCR5 likely participates in demyelination in the spinal cord in experimental autoimmune encephalomyelitis. PMID: 26985768
  8. These results demonstrate that CCR5 plays an important role in neuroplasticity, learning, and memory, and indicate that CCR5 contributes to cognitive deficits caused by HIV. PMID: 27996938
  9. Ccr5 is crucial in directing T cells toward the Langat virus-infected brain and suppressing neutrophil-mediated inflammation within the Central Nervous System. PMID: 27183602
  10. This study showed that CCR5 ablation exacerbated Japanese encephalitis without altering viral burden in extraneural and CNS tissues, as manifested by increased CNS infiltration of Ly-6C(hi) monocytes and Ly-6G(hi) granulocytes. PMID: 27439902
  11. This review discusses the role of CCR5 in the recruitment and activation of myeloid-derived suppressor cells in melanoma. PMID: 28382399
  12. These results suggested that CCR5 signaling is involved in embryo loss during Toxoplasma gondii infection in early pregnancy, and that apoptosis is associated with embryo loss rather than direct damage to the fetoplacental tissues. PMID: 28630065
  13. The upregulation of CCR5 on the surface of CD8(+) T cells increases the number of contacts with Ag-bearing dendritic cells, ultimately resulting in an increased CD8(+) T cell response to Ag rechallenge. PMID: 26994221
  14. The CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in the bone cavity. PMID: 27177471
  15. Cytokine-induced killer cells interact with tumor lysate-pulsed dendritic cells via CCR5 signaling. PMID: 27216980
  16. This study shows that diosgenin-mediated anti-allergic effects are associated with an increased number of Foxp3+ Treg cells expressing CCR5. PMID: 27886644
  17. CCR5 deficiency increased the production of TNF-alpha following LPS treatment through increased activation of the p38 pathway in the kidney, resulting in renal apoptosis and leukocyte infiltration, and leading to exacerbation of LPS-induced acute kidney injury. PMID: 26055553
  18. In West Nile virus infection of the central nervous system, CCR5 activity is required to limit viral burden in the cerebral cortex. PMID: 26667390
  19. Data show that the activation of mammalian target of rapamycin complex mTORC1 during encephalomyocarditis virus infection is chemokine (C-C) receptor 5-dependent and promotes the translation of inducible NO synthase (iNOS) and cyclooxygenase (COX)-2. PMID: 26408666
  20. CCL5-induced endothelial progenitor cell migration was increased by overexpression of CCR5, and that increase was abolished by addition of CCL5 antibody, suggesting CCL5/CCR5 interaction is involved in the chemotactic effects of endothelial progenitor cells. PMID: 25889019
  21. These findings show that migration and activation of immune cells via CCR5 are required for controlling N. caninum parasites during the early phase of infection. PMID: 25558986
  22. Our results suggest that the detrimental effects of C5a in this model are partly mediated through CCR5 activation downstream of C5aR1, which may be evaluated for potential therapeutic exploitation in ALI/ARDS. PMID: 25999468
  23. CCR5 blockade promotes M2 macrophage activation and improves locomotor activity after spinal cord injury in mice. PMID: 25212047
  24. CCR5 KO mice show less cartilage degeneration but no change in bone or synovial response to medial meniscal destabilization. PMID: 25498590
  25. Results indicate that CCR5 deficiency modifies the nigrostriatal dopaminergic neuronal system, and bidirectional interaction between neurons and glial cells via CCR5 might be important for dopaminergic neuronal survival. PMID: 22922220
  26. These data bring new insights on the association between viral infections and the chemokine receptor CCR5. PMID: 25939314
  27. CCR5 is essential to the control of T. gondii infection and to maintain metabolic, hepatic, and intestinal integrity. PMID: 25119429
  28. Mycobacterium infection significantly increased CCR5 expression in macrophages, thereby facilitating the activation of its downstream signaling. These events culminated in the up-regulation of the immunosuppressive cytokine IL-10 production. PMID: 24695099
  29. These results reveal novel alloreactive CD8 T cell specificities in CCR5-deficient recipients of single class II MHC renal allografts that mediate rejection of the allografts. PMID: 25172484
  30. This study provides evidence for an indirect pathologic role of CCR5 and a novel protective effect of LCN2 in combination with inhibition of CCR5 in HIV-associated brain injury. PMID: 25031461
  31. CCR5 mediates neutrophil recruitment in acute lung injury. PMID: 23860188
  32. CCL3-CCR5-mediated fibroblast accumulation may be required, in addition to leukocyte infiltration, to induce full-blown colitis-associated carcinogenesis. PMID: 24510316
  33. This study for the first time demonstrates the importance of TLR2/CCR5 crosstalk as a significant determinant of Leishmania donovani entry in host macrophages. PMID: 24617012
  34. Inflammation-induced hepatocellular carcinoma is dependent on CCR5 in mice. PMID: 23526353
  35. Absence of CCR5 delays the resolution of inflammatory responses triggered by single-walled carbon nanotubes. PMID: 22438032
  36. The CCR5/MIP-1alpha axis may contribute to migration of infected cells to the brain and consequently affect the pathogenesis during Rocio virus infection. PMID: 24080631
  37. These findings suggest that, while CCR5 plays a minor role in regulating immune cell infiltration and inflammation in metabolic tissues, deficiency of CCR5 impairs systemic glucose tolerance as well as adipose tissue and muscle insulin signaling. PMID: 23941876
  38. Pain responses of CCR5 knockout mice to chemical or inflammation stimuli are milder than those of CCR5 wild-type mice. PMID: 23147416
  39. These results suggest that the absence of CCR5 may boost the immune response with a high neutrophil recruitment, which most likely helps in viral clearance. PMID: 23391218
  40. Data indicate an expansion of CXCR3(+) and CCR5(+) T cells was observed in the tumor. PMID: 23326300
  41. The critical mechanism underlying the enhanced effect of CCR5-transduced neural stem cells on experimental autoimmune encephalomyelitis is the early migration of chemokine receptor-transduced NSCs into the inflamed foci. PMID: 22526024
  42. CCR5 deficiency suppressed lung tumor development through the inhibition of nuclear factor-kappaB/STAT3 pathways and the downregulation of MCP-1 in the carcinogen-induced lung tumor model. PMID: 22907530
  43. The immune responses against JEV in mice lacking expression of the chemokine receptor CCR5. PMID: 23028638
  44. Identification of the human immunodeficiency virus (HIV) co-receptor CCR5 as a cellular determinant required for cytotoxic targeting of subsets of myeloid cells and T lymphocytes by the S. aureus leukotoxin ED (LukED). PMID: 23235831
  45. These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain. PMID: 22528550
  46. Leukostasis in early diabetic retinopathy involves activated CCR5(+)CD11b(+) myeloid cells (presumed monocytes). PMID: 22677420
  47. Analysis of transmembrane protein aptamers that inhibit CCR5 expression and HIV coreceptor function. PMID: 22811524
  48. Potent in vivo suppression ability of CD103-positive regulatory T cells (Treg) is not due to stronger suppression ability per cell but due to their tissue migration ability through CCR5 expression. PMID: 22664873
  49. The results showed that CCR5 deficiency caused apoptotic cell death of melanoma through inhibition of NF-kappaB and upregulation of IL-1Ra. PMID: 22567084
  50. It was shown that CCR5 plays a critical role in adipose tissue macrophage recruitment and polarization and subsequent development of insulin resistance. PMID: 22474027

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse CCR5?

Mouse CCR5 belongs to the large family of seven transmembrane proteins coupled to G proteins. It shares structural similarities with other chemokine receptors expressed on lymphocytes and immune cells. The receptor contains an N-terminal extracellular domain critical for ligand binding, seven transmembrane helices that traverse the cell membrane, and intracellular loops that interact with G proteins for signal transduction. Molecular modeling studies have used homology modeling to predict mouse CCR5 structure, building upon known structures of similar G protein-coupled receptors. These models typically include energy minimization within phosphatidyl-ethanolamine lipid membranes to better represent the native environment of CCR5 . Three-dimensional models have been generated through molecular dynamic simulations using the AMBER14 force field and explicit water molecules to better understand receptor conformational dynamics.

What are the primary ligands for mouse CCR5?

Mouse CCR5 interacts primarily with several CC chemokines, including CCL5 (RANTES), CCL3 (MIP-1α), and CCL4 (MIP-1β). These chemokines bind to the extracellular domains of CCR5 with varying affinities, triggering signaling cascades that regulate immune cell recruitment and function. Among these, CCL5 demonstrates high binding affinity and functional significance in mouse models. Research has shown that CCL5 interactions with CCR5 play crucial roles in inflammatory processes, including T-cell and macrophage migration. In vitro chemotaxis assays have demonstrated that exposure to 100 ng/ml recombinant mouse CCL5 results in significant increases in chemotaxis for both CD4+ and CD8+ T cells, as well as thioglycolate-elicited macrophages, confirming the functional importance of this receptor-ligand interaction .

What are the most effective methods for detecting mouse CCR5 expression?

Detection of mouse CCR5 requires sensitive methods due to its generally low expression levels under normal physiological conditions. Researchers should consider multiple complementary approaches:

  • RT-PCR: This method allows for sensitive detection of CCR5 mRNA transcripts. Quantitative RT-PCR is particularly valuable for comparing expression levels across different tissues or conditions.

  • Immunohistochemistry: Using specific antibodies against mouse CCR5, such as purified F(ab')2 fragments directed against the NH2-terminus of muCCR5, allows visualization of protein expression in tissue sections. This approach has been successfully used to detect CCR5 expression in delayed-type hypersensitivity reactions .

  • Flow cytometry: For cellular expression analysis, flow cytometry using fluorescently labeled antibodies provides quantitative data on CCR5 surface expression at the single-cell level.

  • Western blotting: For protein-level detection in tissue or cell lysates, though sensitivity may be limited compared to other methods.

When designing experiments, it's critical to include appropriate positive controls, such as activated T cells or macrophages, as CCR5 expression in mice is typically low in resting conditions and upregulated during immune activation .

How should researchers approach experimental models for studying mouse CCR5 function?

Selecting appropriate experimental models is crucial for meaningful CCR5 functional studies:

Model TypeApplicationsConsiderationsCitations
Cell Line-BasedBasic receptor mechanics, signalingLimited physiological relevance
Primary Cell CulturesNatural receptor expression, cell-specific functionsVariable expression levels, technical challenges
DTH Mouse ModelCellular immunity, allergic responsesDemonstrates natural upregulation of CCR5
Viral Infection ModelsCoreceptor function, immune responseComplex pathology, multiple variables
Genetic Models (knockouts/mutations)Loss-of-function studiesPotential compensatory mechanisms

When designing experiments, researchers should consider that mouse CCR5 expression varies significantly based on immune activation state. For instance, models of delayed-type hypersensitivity show detectable CCR5 expression on macrophages, while certain inflammatory models like P. acnes-induced hepatitis do not induce significant CCR5 expression . This suggests that CCR5 may be preferentially involved in certain types of immune responses, particularly those mediated by cellular immunity rather than acute inflammatory processes. Creating appropriate positive and negative controls is essential for accurately interpreting results from these models.

What are the critical controls needed in mouse CCR5 functional studies?

Establishing proper controls is essential for valid interpretation of CCR5 functional studies:

  • Expression controls: Include tissues or cells known to express CCR5 (activated T cells, macrophages) and those known not to express it.

  • Antibody specificity controls: For immunological detection methods, include isotype controls and blocking peptides to verify antibody specificity.

  • Functional assay controls: For chemotaxis studies, include positive controls (cells responding to known chemoattractants) and negative controls (medium without chemokines).

  • Receptor antagonist controls: Use CCR5 antagonists or blocking antibodies to confirm that observed effects are specifically mediated through CCR5.

  • Genetic controls: When possible, include CCR5-deficient cells or tissues as negative controls.

In chemotaxis assays evaluating CCR5 function, treatment with anti-CCL5 monoclonal antibodies has been shown to significantly reduce (p ≤ 0.01) the migration capability of both T cells and macrophages in response to recombinant CCL5, demonstrating the specificity of the receptor-ligand interaction . Such antibody-based inhibition provides an excellent control method to confirm that observed migration is genuinely CCR5-dependent.

What are the optimal expression systems for producing recombinant mouse CCR5?

Producing functional recombinant mouse CCR5 presents significant challenges due to its nature as a membrane protein with multiple transmembrane domains. Several expression systems can be employed, each with specific advantages:

  • E. coli-based systems: While challenging for full-length CCR5, bacterial systems have been successfully used to express N-terminal fragments of mouse CCR5 fused to GST tags. This approach was demonstrated in studies where the 5' terminal extracellular binding domain (38 amino acids) of mouse CCR5 was expressed as a GST fusion protein for antibody production .

  • Mammalian expression systems: HEK293 or CHO cells provide more native post-translational modifications and proper folding, crucial for functional studies of the receptor.

  • Insect cell systems: Baculovirus-infected Sf9 or High Five cells offer a compromise between yield and post-translational modifications.

  • Cell-free systems: Emerging approaches for membrane proteins that can allow controlled incorporation into nanodiscs or liposomes.

For functional studies, mammalian expression systems generally yield the most physiologically relevant recombinant CCR5, though at lower quantities than microbial systems. The choice of expression system should be guided by the specific experimental requirements, balancing protein yield with functional integrity.

What purification strategies yield the highest quality recombinant mouse CCR5?

Purification of membrane proteins like CCR5 requires specialized approaches:

  • Detergent solubilization optimization: Screening multiple detergents (DDM, LMNG, CHS combinations) to identify conditions that maintain CCR5 stability.

  • Affinity chromatography: Utilizing tags (His, FLAG) or ligand-based affinity methods for initial capture.

  • Size exclusion chromatography: Critical for removing aggregates and ensuring monodispersity.

  • Reconstitution into membrane mimetics: Incorporation into nanodiscs, liposomes, or other membrane mimetics to maintain native-like environment.

Quality assessment should include functional binding assays to confirm that purified CCR5 retains ligand-binding capability. For structural studies, additional considerations include protein stability and homogeneity, often assessed through techniques like thermal shift assays and analytical ultracentrifugation. When developing purification protocols, researchers should continuously monitor receptor conformation and ligand binding capacity to ensure the biological relevance of the purified protein.

How can researchers verify the functionality of recombinant mouse CCR5?

Verification of recombinant CCR5 functionality requires multiple complementary approaches:

  • Ligand binding assays: Using labeled chemokines (particularly CCL5/RANTES) to confirm binding capacity through techniques like surface plasmon resonance or fluorescence-based binding assays.

  • Signaling assays: Measuring calcium flux, GTPγS binding, or downstream pathway activation (MAPK, Akt) in response to ligand stimulation.

  • Chemotaxis assays: Confirming the ability of the recombinant receptor to induce cell migration when expressed in appropriate cell types.

  • Antibody recognition: Using conformationally-sensitive antibodies to verify proper folding.

Studies have demonstrated that functional CCR5 should respond to CCL5 stimulation by inducing chemotaxis in appropriate cellular contexts. In research using virus-specific T cells, exposure to 100 ng/ml recombinant mouse CCL5 resulted in significant increases in chemotaxis for both CD4+ and CD8+ T cells, an effect that could be blocked by pre-incubation with anti-CCL5 monoclonal antibodies . This type of functional assessment provides strong evidence for proper receptor activity.

How does mouse CCR5 contribute to viral infection models?

Mouse CCR5 plays significant roles in viral infection models, particularly in neuroinflammatory conditions:

  • Coronavirus models: In mouse hepatitis virus (MHV) infection models, CCR5 and its ligands (particularly CCL5) contribute to both host defense and disease pathology. During viral encephalomyelitis, CCR5 mediates the recruitment of T cells and macrophages into the CNS, which is essential for viral clearance but also contributes to demyelination .

  • Chemokine signaling: CCL5 (RANTES) binds to CCR5 and promotes migration of virus-specific T cells and macrophages. Neutralization of CCL5 using monoclonal antibodies has been shown to significantly reduce T cell and macrophage infiltration into the CNS of MHV-infected mice, confirming the importance of this receptor-ligand interaction in inflammatory cell recruitment .

  • Differential effects on T cell subsets: Interestingly, antibody neutralization of CCL5 has been shown to differentially affect T cell subsets based on their antigen specificity. In MHV infection models, anti-CCL5 treatment resulted in a 73% reduction in virus-specific CD4+ T cells but only a 60% reduction in virus-specific CD8+ T cells, suggesting differential dependence on CCR5 signaling between T cell subsets .

These findings highlight the complex role of CCR5 in viral pathogenesis, where it contributes to both protective immunity and immunopathology, making it a potential therapeutic target for modulating disease outcomes.

What role does CCR5 play in autoimmune and inflammatory mouse models?

CCR5 exhibits distinct roles across different inflammatory and autoimmune conditions:

  • Delayed-type hypersensitivity: Mouse CCR5 is upregulated in DTH reactions, suggesting its involvement in allergic processes mediated by cellular immunity. Immunohistochemical analysis has demonstrated positive CCR5 expression on macrophages in DTH models .

  • Demyelinating diseases: In mouse models of viral-induced demyelination that mimic multiple sclerosis, CCR5 and its ligand CCL5 are localized in white matter tracts undergoing demyelination. Neutralization of CCL5 significantly reduces (p ≤ 0.005) the severity of demyelination and macrophage accumulation within the CNS, improving neurological function .

  • Acute inflammatory conditions: Interestingly, CCR5 expression is not significantly upregulated in certain acute inflammatory conditions, such as P. acnes-induced fulminant hepatitis, suggesting specificity in its inflammatory roles .

  • Neuroinflammation: CCR5 contributes to neuroinflammatory processes by facilitating T cell and macrophage entry into the CNS. Targeting the CCR5-CCL5 axis can reduce inflammation and improve outcomes in models of neuroinflammatory disease .

These varied roles underscore the context-dependent function of CCR5 in different immune-mediated pathologies, highlighting the importance of considering disease-specific mechanisms when targeting this receptor therapeutically.

How can mouse CCR5 research inform human therapeutic development?

Translating mouse CCR5 research to human applications requires careful consideration of several factors:

This translational approach allows mouse CCR5 research to serve as a foundation for human therapeutic strategies while acknowledging the limitations and necessary adaptations required for successful clinical application.

What molecular modeling approaches are most effective for studying mouse CCR5 structure-function relationships?

Advanced computational approaches provide valuable insights into CCR5 structure and function:

  • Homology modeling: Utilizes known structures of related GPCRs to predict CCR5 conformation. Effective models merge multiple template structures (such as PDB files 5UIW, 5T1A, 5LWE, and 4RWS) to create comprehensive structural predictions .

  • Molecular dynamics simulations: Simulations of CCR5 embedded in phosphatidyl-ethanolamine lipid membranes with explicit water molecules provide dynamic insights into receptor behavior. Using force fields like AMBER14 with simulations running for hundreds of nanoseconds reveals conformational changes relevant to ligand binding and signaling .

  • Ligand docking studies: Computational docking of chemokines and small molecule antagonists helps predict binding modes and key interaction residues.

  • Energy minimization approaches: Optimization of receptor structures using physics-based calculations at physiologically relevant pH (7.4) improves model accuracy .

These computational approaches complement experimental data and provide mechanistic hypotheses that can be tested experimentally. For educational and collaborative purposes, the resulting models can be converted to shareable formats and uploaded to repositories like FigShare or used to generate 3D-printed models for structural analysis .

What are the most sensitive approaches for measuring CCR5-ligand interactions?

Quantifying CCR5-ligand interactions requires sophisticated techniques that balance sensitivity with physiological relevance:

  • Surface plasmon resonance (SPR): Provides real-time, label-free detection of binding kinetics and affinity constants between purified CCR5 (or CCR5-expressing membrane preparations) and chemokine ligands.

  • Bioluminescence resonance energy transfer (BRET): Allows measurement of receptor-ligand interactions and subsequent conformational changes in living cells.

  • Radioligand binding assays: Traditional approach using radiolabeled chemokines to determine binding parameters through saturation and competition studies.

  • Functional readouts: Measurement of downstream signaling events such as calcium flux, β-arrestin recruitment, or inhibition of cAMP production provides functional confirmation of ligand engagement.

  • Chemotaxis assays: Quantification of cell migration in response to CCR5 ligands provides a functional readout with high physiological relevance. Studies have demonstrated that exposure to recombinant mouse CCL5 at concentrations of 100 ng/ml induces significant chemotaxis in both T cells and macrophages, effects that can be blocked by anti-CCL5 antibodies .

Each approach offers distinct advantages, and combining multiple techniques provides the most comprehensive characterization of receptor-ligand interactions. The choice of method should be guided by the specific research question, with consideration of factors such as the need for quantitative binding parameters versus functional outcomes.

How can researchers effectively analyze CCR5 expression dynamics in complex tissues?

Analysis of CCR5 expression in heterogeneous tissues requires specialized approaches:

  • Single-cell RNA sequencing: Provides cell-type specific expression data in complex tissues, revealing which populations express CCR5 under different conditions.

  • Multiplexed immunofluorescence: Allows simultaneous detection of CCR5 alongside cell type markers and activation states in tissue sections.

  • Flow cytometry and cell sorting: Enables quantitative analysis of CCR5 surface expression across different cell populations isolated from tissues.

  • In situ hybridization techniques: Methods like RNAscope provide sensitive detection of CCR5 mRNA with spatial context in tissue sections.

  • qRT-PCR with cell isolation: Combining cell sorting or laser capture microdissection with qRT-PCR allows quantitative expression analysis from specific cell populations.

Research has demonstrated that CCR5 expression is dynamically regulated in different disease contexts. For example, in models of viral-induced neuroinflammation, treatment with anti-CCL5 antibodies significantly reduced CCR5 mRNA expression in the CNS compared to control-treated animals, suggesting feedback regulation between ligand availability and receptor expression . This highlights the importance of analyzing expression dynamics rather than static expression levels.

What are the current knowledge gaps in mouse CCR5 biology?

Despite significant advances, several critical knowledge gaps remain in our understanding of mouse CCR5:

  • Structure-function relationships: Detailed understanding of how specific structural elements of mouse CCR5 contribute to different signaling outcomes remains incomplete.

  • Tissue-specific roles: The function of CCR5 in non-immune tissues and its contribution to normal physiological processes beyond inflammation requires further investigation.

  • Developmental regulation: The role of CCR5 in developmental processes and how its expression is regulated throughout development is poorly understood.

  • Signaling complexity: The complete signaling network downstream of CCR5 activation, including potential biased signaling in response to different ligands, needs further characterization.

  • Genetic variation impact: The functional consequences of natural genetic variations in mouse CCR5 across different strains and how these might influence disease susceptibility require additional study.

Addressing these knowledge gaps will provide a more comprehensive understanding of CCR5 biology and potentially reveal new therapeutic opportunities. Future research should employ multidisciplinary approaches combining advanced genetic tools, high-resolution imaging, and systems biology to address these complex questions.

What emerging technologies will advance mouse CCR5 research?

The future of CCR5 research will be shaped by several cutting-edge technologies:

  • CRISPR-based approaches: Advanced genome editing enables precise modification of CCR5 or its regulatory elements, facilitating detailed structure-function studies and development of improved mouse models.

  • Cryo-EM and advanced structural biology: These techniques hold promise for determining high-resolution structures of CCR5 in complex with various ligands and signaling partners.

  • Spatial transcriptomics and proteomics: These methods provide unprecedented insights into the expression and function of CCR5 within the spatial context of tissues.

  • Optogenetic and chemogenetic tools: Allow temporal control of CCR5 signaling for dissecting its acute versus chronic roles in various physiological and pathological processes.

  • Artificial intelligence approaches: Machine learning methods can integrate diverse datasets to predict CCR5 function in different contexts and guide experimental design.

By embracing these technologies, researchers can develop a more integrated understanding of CCR5 biology that spans from molecular mechanisms to physiological outcomes. This comprehensive approach will be essential for translating basic research findings into clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.