Recombinant Mouse C-C chemokine receptor type 7 (Ccr7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have any specific format requirements, kindly include them in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. We recommend consulting your local distributors for precise delivery estimates.
Note: All of our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Ccr7; Cmkbr7; Ebi1; Ebi1h; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; Epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-378
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
QDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYI YFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSG EDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPF LYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP
Uniprot No.

Target Background

Function
C-C chemokine receptor type 7 (CCR7) is a receptor for the MIP-3-beta chemokine.
Gene References Into Functions

CCR7: A Key Regulator of Immune Cell Trafficking and Function

CCR7 plays a critical role in the immune system, primarily by guiding the migration of immune cells, particularly dendritic cells (DCs) and T lymphocytes, to secondary lymphoid organs, such as lymph nodes. This movement is crucial for initiating and regulating adaptive immune responses.

Key Functions and Research Highlights:

  1. Directing Immune Cell Migration: CCR7 mediates the migration of CD11c+ cells from the central nervous system (CNS) to the meningeal lymphoid vessels and subsequently to the deep cervical lymph nodes during neuroinflammation. In the absence of CCR7, DCs remain in the CNS, exacerbating neuroinflammation. (PMID: 28216674)
  2. Optimizing Dendritic Cell Guidance: CCL21 gradients, which are essential for optimal DC guidance, are measured in vivo. The termination of CCR7 signaling by G-protein-coupled receptor kinase 6 (GRK6) is critical for haptotactic but not chemotactic CCL21 gradient sensing in vitro and in vivo. (PMID: 28457871)
  3. Regulating Dendritic Cell Subset Dynamics: CCR7 deficiency leads to apoptosis of Sirpa- DCs, counterbalanced by an expansion of immature Sirpa+ DCs, which efficiently induce regulatory T cell (Treg) generation. (PMID: 28978470)
  4. Promoting Arteriogenesis: The CCR7-CCL19/CCL21 axis facilitates the retention of CD4(+) T lymphocytes at the site of collateral artery remodeling, a crucial process for effective arteriogenesis. (PMID: 28275068)
  5. Influencing Mammary Tumor Progression: CCR7 deficiency results in decreased levels of activated Notch1, indicating that crosstalk between CCR7 and Notch1 promotes stemness in mammary cancer cells, potentially contributing to mammary tumor progression. (PMID: 28137279)
  6. Modulating Adipose Tissue Inflammation: CCR7 deficiency leads to an accumulation of CD8+ adipose tissue leukocytes, further exacerbated by a high-fat diet. (PMID: 27655794)
  7. Involvement in Salmonella Resistance: The Ity8 locus on chromosome 15, linked to Salmonella resistance in AcB60 mice, was validated through interval mapping. Gene expression analysis during infection identified AcB60-specific expression of genes involved in Ccr7 signaling, including downstream effector Mapk11, potentially a positional candidate gene within the Ity8 interval. (PMID: 27913859)
  8. Regulating Memory T Cell Subsets: CCR7 biases memory CD8 T cells towards IL-7-dependent niches over IL-15-dependent niches, providing insights into the homeostatic regulation of different memory T cell subsets. (PMID: 27385825)
  9. Enhancing Bacterial Clearance in the Female Reproductive Tract: Prominent mucosal immune responses in CCR7-deficient mice lead to more efficient bacterial clearance from the female reproductive tract while reducing tissue-associated inflammation and pathology. Increased lymphocyte numbers within the female reproductive tract contribute to pathogen clearance with reduced immune-mediated pathology. (PMID: 28801359)
  10. Promoting Th17-like Responses: CCR7 is required for a robust immune response against enteropathogenic Yersinia pseudotuberculosis by promoting Th17-like responses in mesenteric lymph nodes. (PMID: 28329174)
  11. Inducing Immune Tolerance: Overexpression of CCR7 and knockdown of RelB in immature DCs improves skin-graft survival in a murine skin-transplantation model. Transfection with Ad-CCR7 and RelB knockdown in immature DCs may be an effective approach to inducing immune tolerance, potentially valuable for inhibiting allograft rejection. (PMID: 28578354)
  12. Limiting Neuroinflammation: Data suggests that CCR7 is a critical host defense restriction factor that limits neuroinflammation during acute West Nile virus infection. (PMID: 28356527)
  13. Maintaining Innate and Adaptive Immunity in Obesity: CCR7 plays a causal role in maintaining innate and adaptive immunity in obesity. (PMID: 27207557)
  14. Modulating Dendritic Cell Phenotype: Cooverexpression of CCR7 and BTLA in immature DCs imparts an intermediate immune phenotype compared to CCR7- or BTLA-expressing counterparts, which exhibit more immunocompetent or immunotolerant phenotypes, respectively. (PMID: 28393074)
  15. Inhibiting Airway Inflammation: Baicalin, a natural compound, exerts an inhibitory effect on airway inflammation, potentially associated with the inhibition of CCR7 and its ligands, CCL19 and CCL21, as well as the nuclear factor-Kappa B (NF-kappaB) pathway in a mouse model of asthma. (PMID: 27666000)
  16. Regulating Treg Recirculation: CCR7 plays a role in limiting Treg recirculation back to the thymus, enabling the separation of mechanisms controlling Treg production and thymic recirculation. (PMID: 26832402)
  17. Preventing Lethal Neuroinflammatory Disease: CCR7 expression on antiviral T cells is mandatory to prevent lethal neuroinflammatory disease. (PMID: 26921107)
  18. Influencing Collecting Vessel Permeability and Fibrosis: CCR7 plays multifaceted roles in regulating collecting vessel permeability and fibrosis, with IRF4-dependent DCs being key players. (PMID: 26999610)
  19. Determining DC Trafficking in Allograft Rejection: The graft site microenvironment plays a critical role in alloimmunity by determining DC trafficking through the CCR7-CCL19/21 axis. (PMID: 27031839)
  20. Reduced Expression in Experimental Autoimmune Encephalomyelitis: CCR7 expression is reduced in mononuclear inflammatory cells isolated from the brain during the active stage of experimental autoimmune encephalomyelitis. (PMID: 25957582)
  21. Differential Requirement for Primary and Secondary CD8 T Cell Responses: CCR7 regulates effector CD8 T cell migration in the spleen, demonstrating a differential requirement for primary and secondary CD8 T cell responses to infection. (PMID: 26500349)
  22. Trafficking of RORgamma Innate Lymphoid Cells: Mucosal draining lymph nodes express CCR7, playing a role in trafficking of RORgamma innate lymphoid cells. (PMID: 25575242)
  23. Enhancing BCR-ABL-mediated Cell Growth: CCR7 contributes to STAP-2-dependent enhancement of BCR-ABL-mediated cell growth in Ba/F3 cells. (PMID: 26102025)
  24. Modulating Nitric Oxide Secretion and T Cell Immune Response: CCR7 increases nitric oxide secretion and modulates the T cell immune response. (PMID: 25549354)
  25. Regulating Immature Dendritic Cell Migration: Mfn2 and OPA1 are upregulated during bone marrow progenitor differentiation and promote the migration of immature DCs by regulating CCR7 expression. (PMID: 25387754)
  26. Regulating Intestinal TH1/TH17/Treg Balance: CCR7 regulates the intestinal TH1/TH17/Treg balance during Crohn's-like murine ileitis. (PMID: 25637591)
  27. Reversing Impaired DC Homing: Rescue with both CCR7 and ICAM-1 reverses impaired DC homing to lymph nodes in vivo when FOXO1 is deleted. (PMID: 25786691)
  28. Silencing during Monocyte-Derived Dendritic Cell Differentiation: Ccr7 is gradually silenced during the differentiation of monocytes to monocyte-derived dendritic cells. (PMID: 25297875)
  29. Importance for Leishmania major Infection: CCR7 is required for a protective immune response to intracellular L. major infection. (PMID: 24205367)
  30. Intensifying Immunomodulatory Effects of Mesenchymal Stromal Cells: CCR7 guides the migration of mesenchymal stromal cells to secondary lymphoid organs, significantly intensifying their immunomodulatory effects in vivo. (PMID: 24496849)
  31. Role in Corneal and Ocular Surface Diseases: The involvement of DCs and their expression of CCR7 in corneal and ocular surface diseases, including ocular allergy, dry eye disease, and immune rejection, is reviewed. (PMID: 24725321)
  32. Recruitment of T Cells to Inflamed Pancreatic Islets: CCR7 directs the recruitment of T cells into inflamed pancreatic islets of nonobese diabetic (NOD) mice. (PMID: 24687731)
  33. Social Novelty and Maternal Separation: Reduced interest in social novelty in response to maternal separation is observed in CCR7-/-, but not wild-type mice. (PMID: 24503116)
  34. Potential Role in Cognition, Learning, and Anxiety: CCR7 may play a role in cognition and learning behavior, as well as anxiety and other behaviors. (PMID: 24333375)
  35. Importance in Intrathymic T Cell Development: Novel roles for CCR7 are identified during intrathymic T cell development, highlighting its importance in enabling multiple alphabetaT cell lineages to access the adult thymic medulla. (PMID: 24990081)
  36. Gammadelta T-Cell Localization: CCR7 and CCR9 expression is important for gammadelta T-cell localization within the thymic medulla or cortex, respectively. (PMID: 24500801)
  37. Essential for Leishmania major Immune Response: CCR7 expression on both dendritic cells and peripheral cells is essential for an efficient immune response to Leishmania major. (PMID: 24410820)
  38. Impaired Post-Thrombotic Vein Wall Remodeling: Post-thrombotic vein wall remodeling is impaired in CCR7(-/-) mice, with a profibrotic phenotype, dependent on the thrombotic mechanism, and mediated by circulating CCR7(+) cells. (PMID: 24311382)
  39. Defining Regulatory T Cell Subsets: CCR7 provides localized access to IL-2 and defines homeostatically distinct regulatory T cell subsets. (PMID: 24378538)
  40. Initiating Th2 Differentiation: TSLP activates a subset of CD11b(+) DCs in the skin to produce CCL17, upregulate CCR7, and migrate to the draining lymph node to initiate Th2 differentiation. (PMID: 24123684)
  41. Target Genes of Foxo1: Chromatin immunoprecipitation sequencing revealed the transcription factor Tcf7 and the chemokine receptor Ccr7 as Foxo1-bound target genes, playing critical roles in central-memory T cell differentiation and trafficking. (PMID: 23932570)
  42. No Discernible Role in Trafficking of Ag-Experienced CD4 T Cells: Current findings do not support the notion that CCR7 plays a significant role in the trafficking of Ag-experienced CD4 T cells to the lymph nodes. (PMID: 23935190)
  43. Exacerbating Atherosclerosis: Genetic deletion of Ccr7 exacerbates atherosclerosis by increasing T cell accumulation in atherosclerotic lesions. (PMID: 23180724)
  44. CD62L-Independent Pathway for Naive Lung CD4 Cells: Data indicates that naive lung CD4 cells supply the draining lymph nodes through a CD62L-independent, CCR7-dependent pathway. (PMID: 23319636)
  45. Diminished Immunosurveillance in the Skin: Exposure to CCR7 in a model of contact hypersensitivity following sublethal total body irradiation results in diminished immunosurveillance in the skin, potentially rendering the host more susceptible to pathogens. (PMID: 23002435)
  46. Link between CCR7 Expression, IL-1beta Level, and Na Malabsorption: These data suggest a causal link between CCR7 expression, IL-1beta level, and Na malabsorption due to altered ENaC expression and diarrhea. (PMID: 22395421)
  47. Role of Phosphatidylinositol 3-kinase and NF-kappa B Signaling in CCR7-Mediated IL-23 Production: Phosphatidylinositol 3-kinase and NF-kappa B signaling pathways play a critical role in CCR7-mediated IL-23 production by murine dendritic cells. (PMID: 22591694)
  48. Requirement for Plasmacytoid Dendritic Cell Trafficking: Plasmacytoid dendritic cells (pDCs) trafficking to the splenic white pulp requires CCR7 signaling. (PMID: 22634622)
  49. Contribution to Allergic Conjunctivitis: CCR7 expression contributes to the immunopathogenesis of allergic conjuctivitis, allowing for significant inhibition of this condition through topical CCR7 antibody blockade. (PMID: 22507838)
  50. CCR7-Independent Transport: Cell sorting highlighted the involvement of CD11c(+) cells in CCR7-independent transport. (PMID: 22622847)

Show More

Hide All

Database Links

KEGG: mmu:12775

STRING: 10090.ENSMUSP00000099423

UniGene: Mm.2932

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CCR7 and what are its primary ligands?

CCR7 is a 7-transmembrane G protein-coupled receptor that plays a critical role in immune cell trafficking and lymphoid tissue organization. It specifically recognizes and binds to the homeostatic chemokines CCL19/MIP-3 beta and CCL21/6Ckine. These ligands are constitutively expressed by high endothelial venule epithelial cells and fibroblastic reticular cells in secondary lymphoid organs . When studying CCR7-ligand interactions, researchers typically employ techniques such as radioligand binding assays, calcium flux assays, and chemotaxis experiments.

To analyze CCR7 expression in experimental settings, researchers can use the Human/Mouse CCR7 Primer Pair for qPCR detection of transcripts. For functional studies, recombinant proteins of CCR7 ligands (like CCL19) can be used in migration assays to assess receptor activity in various cell populations.

How does CCR7 expression change during immune cell activation?

CCR7 undergoes dynamic regulation during immune cell activation, particularly in cells central to adaptive immunity. Following inflammatory stimulation, CCR7 is upregulated on dendritic cells, naïve and memory T cells, regulatory T cells (Treg), natural killer (NK) cells, and B cells . This upregulation enables these immune cells to traffic to and be retained within regional lymph nodes, facilitating the expansion of adaptive immune responses.

For experimental analysis of CCR7 expression changes, researchers commonly employ flow cytometry with fluorophore-conjugated anti-CCR7 antibodies. This allows for quantitative assessment of receptor levels at the protein level across different immune cell subsets. At the transcriptional level, qPCR using specific primers provides complementary data on expression dynamics.

What are the main functional roles of CCR7 in the immune system?

CCR7 performs several critical functions in the immune system:

  • Directs the migration of mature dendritic cells from peripheral tissues to draining lymph nodes

  • Guides naïve and memory T cells to T cell zones in secondary lymphoid organs

  • Facilitates the organization of lymphoid tissue architecture

  • Contributes to the magnitude and kinetics of antiviral CTL responses

  • Uses distinct signaling modules to control survival, chemotaxis, and cytoskeletal dynamics in dendritic cells

To study these functions experimentally, researchers use various models including CCR7-knockout mice, which display altered lymphoid organ architecture, reduced T cell numbers in lymph nodes, and impaired dendritic cell migration . In vitro migration assays like Transwell systems can measure CCR7-dependent chemotaxis, while adoptive transfer experiments allow for tracking cell movement in vivo.

Which experimental approaches are recommended for detecting CCR7 expression in mouse tissues?

For comprehensive analysis of CCR7 expression in mouse tissues, researchers should consider multiple complementary techniques:

  • Flow cytometry: The gold standard for quantifying CCR7 protein expression on specific cell populations. Single-cell suspensions from tissues can be stained with fluorochrome-conjugated CCR7 antibodies and analyzed alongside lineage markers.

  • Quantitative RT-PCR: Using specific primers like the Human/Mouse CCR7 Primer Pair (RDP-238) , researchers can detect CCR7 mRNA levels in tissue samples. This approach is particularly useful for quantitative comparisons across tissues or treatment conditions.

  • Immunohistochemistry/Immunofluorescence: Allows visualization of CCR7 expression within the tissue architecture, providing spatial context that is lost in flow cytometry and qPCR.

  • Western blotting: Useful for detecting total CCR7 protein levels in tissue lysates, though less informative about cellular distribution than other methods.

When interpreting results, researchers should be aware that CCR7 expression can be affected by tissue processing methods and that surface expression may not always correlate with functional responsiveness to ligands.

How do CCR7 signaling pathways differ between immune cell types?

CCR7 activates distinct signaling pathways that can vary significantly between immune cell types:

In dendritic cells, CCR7 uses three main signaling modules with remarkable specificity:

  • The PI3K/Akt pathway primarily controls survival

  • The MAPK pathway specifically regulates chemotaxis

  • RhoA pathways govern actin dynamics, affecting migration speed, cell morphology, and endocytosis

Remarkably, these signaling pathways function with a high degree of independence in dendritic cells, operating as discrete modules with biased functionality . This organization allows for precise control of multiple cellular functions through a single receptor.

In T cells, while similar pathways are activated, their relative importance and interconnections may differ. For example, the kinetics of CCR7-dependent T cell expansion after LCMV infection suggests that signaling outcomes are context-dependent and may vary between cell types and activation states .

What role does CCR7 play in lymph node organization and T cell zone formation?

CCR7 is essential for proper lymphoid tissue architecture and organization. Studies in CCR7-deficient mice have revealed:

  • Aberrantly formed lymphoid T cell zones

  • Strongly reduced T cell numbers in lymph nodes

  • Impaired homing of dendritic cells and naïve T cells

These structural abnormalities have functional consequences. Adoptive transfer experiments have shown that ectopic positioning of dendritic cells and T cells outside organized T cell zones results in reduced priming efficacy . This demonstrates that the CCR7-dependent spatial organization of immune cells within lymphoid tissues is critical for optimal immune responses.

Despite these defects, antiviral protection in CCR7-deficient mice infected with LCMV is ultimately complete, though delayed, indicating that alternative mechanisms can partially compensate for CCR7 deficiency . This suggests that while CCR7 optimizes the efficiency of immune responses, it may not be absolutely required for their eventual effectiveness.

How do researchers study CCR7-dependent immune cell trafficking?

Studying CCR7-dependent cell trafficking requires multiple complementary approaches:

  • In vitro migration assays:

    • Transwell chemotaxis assays using recombinant CCL19/CCL21

    • Live cell imaging with directional chemokine gradients

    • 3D collagen matrix migration to better mimic tissue environments

  • In vivo tracking methods:

    • Adoptive transfer of fluorescently labeled cells (CFSE, cell trackers)

    • Intravital microscopy to visualize cell movement in real-time

    • Flow cytometric analysis of cell accumulation in lymphoid tissues

  • Genetic approaches:

    • CCR7-knockout mice to assess complete loss of function

    • Conditional knockout models for cell-specific deletion

    • CRISPR-modified cells for acute receptor deletion

A particularly informative approach combines CFSE-labeled P14 T cells (which recognize LCMV antigen) with and without CCR7 expression transferred into mice before viral challenge . This allows direct comparison of cell proliferation, migration, and function between CCR7-positive and CCR7-negative cells in the same host environment.

What parameters should be considered when designing experiments with recombinant CCR7 proteins?

When working with recombinant CCR7 proteins, researchers should consider several key parameters:

  • Expression system selection:

    • E. coli: Suitable for peptide fragments but may lack post-translational modifications

    • Mammalian cells: Better for full-length receptor with proper folding and modifications

    • Insect cells: Good compromise between yield and proper processing

  • Purification strategy:

    • Tag selection (His, GST, FLAG) impacts solubility and functionality

    • Detergent choice critical for maintaining membrane protein structure

    • Buffer composition affects stability and activity

  • Functional validation:

    • Ligand binding assays to confirm specificity

    • Signaling reporter systems to verify activity

    • Comparison with native receptor behavior

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles

    • Consider stabilizing additives (glycerol, specific detergents)

    • Monitor activity over time and storage conditions

Similar considerations apply when working with recombinant chemokines like CCL7/MARC, where proper folding and biological activity testing are essential, as seen with the E. coli-expressed mouse MARC/MCP-3 protein that has verified monocyte and T-lymphocyte chemoattractant activity .

How does CCR7 function as both a sensor and sink for CCL19, and what are the implications for immune cell migration?

Recent research has revealed that CCR7 plays a dual role in controlling dendritic cell migration:

  • Sensor function: CCR7 detects CCL19 chemokine gradients, triggering intracellular signaling cascades that direct cellular movement toward higher concentrations of the ligand .

  • Sink function: Dendritic cells can actively shape their chemotactic environment through Lfc-mediated endocytosis of CCR7, effectively "sinking" CCL19 from the surrounding milieu . This creates self-generated chemokine gradients that facilitate accurate migration.

This dual functionality has profound implications for collective leukocyte migration. The self-shaped gradients generated by CCR7-expressing cells can be sensed not only by the gradient-forming cells themselves but also by other responsive cells like T lymphocytes . This mechanism enables coordinated migration of multiple cell types, potentially explaining how immune cells navigate complex tissue environments where pre-established gradients may be insufficient for guiding migration over long distances.

Experimentally, this phenomenon can be studied using microfluidic devices with controlled chemokine inputs, live cell imaging with fluorescently labeled chemokines, and mathematical modeling of gradient formation and cellular responses.

What distinct signaling modules does CCR7 utilize in dendritic cells, and how do they regulate different cellular functions?

CCR7 employs remarkably discrete signaling modules in dendritic cells to control distinct cellular functions:

  • PI3K/Akt pathway:

    • Primarily regulates dendritic cell survival

    • Activates pro-survival mechanisms and controls metabolic programming

    • Functions largely independently of other CCR7-initiated pathways

  • MAPK pathway:

    • Specifically controls chemotaxis in dendritic cells

    • Regulates the directional sensing machinery required for migration

    • Can be selectively inhibited without affecting other CCR7 functions

  • RhoA pathways:

    • Govern actin cytoskeleton dynamics

    • Control migration speed, cell morphology, and endocytosis

    • Operate with significant independence from other signaling modules

Biochemical and functional analyses have demonstrated that these three signaling pathways behave as modules with a high degree of independence . While each pathway can potentially regulate multiple functions in different cellular contexts, CCR7 signaling in dendritic cells creates a functional bias in each pathway, directing them toward specific outcomes.

This modular organization represents an elegant mechanism for how a single receptor can coordinate multiple complex cellular behaviors simultaneously, with minimal cross-interference between different functional outcomes.

How does CCR7 deficiency affect the priming and distribution of antiviral effector and memory T cells?

Studies using CCR7-deficient mice infected with lymphocytic choriomeningitis virus (LCMV) have provided detailed insights into how CCR7 deficiency impacts antiviral T cell responses:

  • Magnitude and kinetics:

    • CCR7-/- mice show reduced numbers of virus-specific CTLs in all lymphoid and nonlymphoid organs tested

    • The CTL response peaks with a delay (day 12 instead of day 8) in CCR7-/- mice

    • The reduced magnitude is reflected in lower delayed-type hypersensitivity reactions

  • Functional development:

    • Despite numerical deficiencies, CCR7-deficient CTLs acquire full effector functionality

    • Antiviral protection is complete but delayed in CCR7-/- mice

    • Surface phenotypes (CD62LlowCD44highCCR5lowCD43high) of virus-specific CTLs are identical in CCR7-/- and CCR7+/- mice

  • Memory phase characteristics:

    • CCR7-/- mice maintain stable LCMV-specific CTL populations, predominantly in nonlymphoid organs

    • These mice rapidly mount protective CTL responses against challenge infections

    • Memory responses can develop despite altered priming conditions

Adoptive transfer experiments using CFSE-labeled P14 T cells revealed that CCR7-deficient T cells show delayed onset of antigen-specific proliferation (no proliferation at day 4 vs. at least five divisions in CCR7-competent cells), though both populations eventually proliferate efficiently by day 7 . This indicates that CCR7 influences the kinetics of initial T cell activation but is not absolutely required for eventual clonal expansion.

What are the methodological considerations for studying CCR7-mediated dendritic cell migration in vitro versus in vivo?

Studying CCR7-mediated dendritic cell migration requires careful consideration of methodological approaches in both in vitro and in vivo settings:

In vitro approaches:

  • Two-dimensional migration assays:

    • Transwell systems with CCL19/CCL21 in the lower chamber

    • Time-lapse microscopy on chemokine-coated surfaces

    • Advantages: Precisely controlled conditions, quantitative readouts

    • Limitations: May not recapitulate the complexity of tissue environments

  • Three-dimensional migration assays:

    • Collagen or matrigel matrices with embedded chemokines

    • Microfluidic devices with defined gradients

    • Advantages: Better mimics tissue architecture

    • Limitations: Still lacks the full complexity of in vivo settings

In vivo approaches:

  • Adoptive transfer methods:

    • Labeled dendritic cells injected into footpads or skin

    • Flow cytometry analysis of draining lymph nodes at various timepoints

    • Advantages: Physiologically relevant, complete migration path

    • Limitations: Lower temporal resolution, influenced by multiple factors

  • Intravital microscopy:

    • Direct visualization of dendritic cell migration within living tissues

    • Can track individual cell behaviors and interactions

    • Advantages: High resolution of cell dynamics in native environments

    • Limitations: Technically challenging, limited to accessible tissues

When designing experiments, researchers should consider that CCR7 in dendritic cells uses specific signaling pathways for different functions - the MAPK pathway specifically controls chemotaxis, while RhoA pathways regulate migration speed via actin dynamics . Therefore, pathway-specific inhibitors can help dissect the molecular mechanisms involved in different aspects of migration.

How does CCR7 expression correlate with cancer progression and what are the implications for immunotherapy?

CCR7 expression has significant implications for cancer progression and potential immunotherapeutic approaches:

These findings highlight the dual roles of CCR7 in cancer biology: it may promote metastasis when expressed by tumor cells but could enhance anti-tumor immunity when properly functioning in immune cells. This duality presents both challenges and opportunities for cancer immunotherapy approaches targeting the CCR7-CCL19/CCL21 axis.

What is the relationship between CCR7 and the kinetics of T cell activation during viral infection?

CCR7 significantly influences the kinetics of T cell activation during viral infection, as demonstrated by studies using lymphocytic choriomeningitis virus (LCMV) infection in CCR7-deficient mice:

These findings demonstrate that CCR7 plays a critical role in determining the kinetics and magnitude of T cell responses without substantially affecting the quality of the eventual response. This temporal optimization may be particularly important in acute infections where the speed of the immune response can determine disease outcome.

How do the signaling pathways downstream of CCR7 integrate with T cell receptor (TCR) signaling?

The integration of CCR7 and TCR signaling represents a sophisticated coordination mechanism in T cell biology:

  • Spatial coordination:

    • CCR7 directs T cells to T cell zones in lymphoid tissues where they are more likely to encounter antigen-presenting cells

    • This increases the probability of TCR engagement with cognate antigen

    • The organized architecture dependent on CCR7 facilitates efficient scanning of dendritic cells by T cells

  • Signaling pathway cross-talk:

    • Both CCR7 and TCR activate overlapping downstream pathways, including MAP kinases and PI3K/Akt

    • CCR7 signaling can lower the threshold for TCR activation through pre-activation of shared signaling components

    • TCR stimulation can modulate CCR7 responsiveness, creating a bidirectional regulatory loop

  • Temporal dynamics:

    • Studies of LCMV infection in CCR7-deficient mice reveal that CCR7 influences the timing of T cell activation

    • While CCR7-deficient T cells eventually proliferate effectively, they show delayed initiation of proliferation compared to CCR7-competent cells

    • This temporal regulation may be critical for coordinating the complex cellular interactions required for optimal immune responses

  • Functional outcomes:

    • The proper integration of CCR7 and TCR signals optimizes both the quantitative (magnitude) and qualitative (effector differentiation) aspects of T cell responses

    • Despite altered kinetics in CCR7-deficient systems, T cells can still acquire appropriate effector phenotypes (CD62LlowCD44highCCR5lowCD43high)

This integration highlights how chemokine receptor signaling extends beyond simply directing cell migration to actively participating in the orchestration of immune cell activation and differentiation programs.

What experimental approaches can be used to study the effects of CCR7 post-translational modifications?

Studying CCR7 post-translational modifications (PTMs) requires sophisticated experimental approaches:

  • Identification strategies:

    • Mass spectrometry-based proteomics to identify specific modification sites

    • Phospho-specific antibodies for detecting phosphorylated receptor forms

    • Metabolic labeling with modification-specific precursors (e.g., 32P, 35S)

    • Chemical biology approaches with modification-specific probes

  • Functional analysis methods:

    • Site-directed mutagenesis to create modification-deficient CCR7 variants

    • Knock-in mouse models expressing PTM-deficient CCR7

    • Specific enzyme inhibitors to prevent particular modifications

    • Temporal analysis correlating modifications with functional changes

  • Cellular assays:

    • Receptor internalization and recycling assays

    • Ligand binding studies comparing modified and unmodified receptor

    • Signaling readouts (calcium flux, phospho-flow, BRET/FRET biosensors)

    • Migration assays to assess functional consequences

  • In vivo approaches:

    • Adoptive transfer of cells expressing wild-type vs. modification-deficient CCR7

    • Conditional expression of modification enzymes

    • Intravital microscopy to track cell behavior in real-time

When designing experiments, researchers should consider the potential interactions between different modifications, as one modification (e.g., phosphorylation) may influence others (e.g., ubiquitination). Additionally, the dynamic nature of PTMs requires careful attention to temporal aspects, potentially necessitating time-course experiments with multiple sampling points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.