Recombinant Mouse C-X-C chemokine receptor type 2 (Cxcr2)

Shipped with Ice Packs
In Stock

Description

Neutrophil Chemotaxis and Inflammation

Cxcr2 binds interleukin-8 (IL-8) and other ELR+ CXC chemokines (e.g., CXCL1, CXCL5) to activate neutrophils via a phosphatidylinositol-calcium second messenger system . Key findings:

  • CXCR2 deficiency reduces neutrophil recruitment by 97% in Streptococcus pneumoniae infections .

  • PTx-sensitive G-proteins mediate endothelial cell chemotaxis toward ELR+ chemokines .

Angiogenesis

CXCR2 drives neovascularization in endothelial cells:

  • In vitro: CXCL1/5 from tumor-associated macrophages (TAMs) induce gastric cancer (GC) cell migration via CXCR2/STAT3 signaling .

  • In vivo: CXCR2−/− mice show impaired corneal neovascularization (vascular density reduced by 91%) compared to wild-type .

Renal Fibrosis and Cellular Senescence

  • CXCR2 overexpression in tubular cells triggers β-catenin activation, mitochondrial dysfunction, and senescence markers (p16, γ-H2AX) .

  • Inhibition with SB225002 reduces fibrosis by 60% in murine unilateral ureteral obstruction (UUO) models .

Disease Modeling

  • Cancer: CXCR2 promotes gastric cancer metastasis by facilitating TAM-GC cell crosstalk (lymph node metastasis rate: 83.3% vs. 33.3% in shCXCR2 models) .

  • Renal Disease: CXCR2 correlates with tubular senescence markers (p16/TOMM20 ratio: r = 0.82) .

Therapeutic Targeting

  • Neutralizing CXCR2 antibodies inhibit endothelial chemotaxis by 97–99% .

  • Small-molecule inhibitors (e.g., SB225002) suppress β-catenin and fibrosis in preclinical models .

Key Research Findings

  1. CXCR2/STAT3 Feed-Forward Loop: In GC, TAM-derived CXCL1/5 activate CXCR2, inducing STAT3 phosphorylation and EMT (Snail upregulation) .

  2. Mitochondrial Dysregulation: CXCR2 reduces PGC-1α and COX1 expression by 70% in renal tubular cells, accelerating senescence .

  3. Ligand Specificity: CXCR2 binds IL-8 (Kd = 0.3 nM) and GROα (Kd = 1.2 nM) with high affinity .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available in liquid or lyophilized powder form.
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will prepare the product accordingly.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Cxcr2; Cmkar2; Gpcr16; Il8rb; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Datasheet & Coa
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKI FSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPIL ILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
CXCR2 is a receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR2 activates neutrophils, triggering a G-protein-mediated response that activates a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high affinity binding to IL-8. It also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.
Gene References Into Functions
  1. CXCR2 plays a critical role in regulating neutrophil recruitment in S. aureus-induced septic arthritis. The kinetics of neutrophil recruitment correlates with the bacterial load recovered from inflamed joints following intra-articular injection of S. aureus. PMID: 29168180
  2. CXCR2 expression is significantly upregulated in band III granulocyte myeloid-derived suppressor cells (G-MDSCs) that exhibit substantial expansion in B16 melanoma, Lewis lung carcinoma, or MC38 colon carcinoma. PMID: 29120053
  3. TIARP independently down-regulates CXCL2 and IL-6 production by fibroblast-like synoviocytes and the expression of chemokine receptors (CXCR1 and CXCR2) in neutrophils, ultimately reducing neutrophil migration into arthritic joints. PMID: 27995997
  4. CXCR2 protein expression is upregulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2-selective antagonist SB225002, administered intraperitoneally during the latency window preceding spontaneous recurrent seizures (SRSs) onset, effectively suppresses SRSs activity during the chronic phase of epilepsy. PMID: 28705496
  5. Microcystin-LR induces inflammation through IL-8/CXCR2 signaling. PMID: 29197248
  6. Research indicates that CXCR2-dependent signaling plays a pivotal role in limiting segmented filamentous bacteria expansion during acute colonization. The findings underscore the central role of neutrophils in controlling this bacterial growth. PMID: 27624780
  7. Combining CSF1R inhibition with a CXCR2 antagonist effectively blocks granulocyte infiltration of tumors and demonstrates strong anti-tumor effects. PMID: 29136508
  8. CXCR2 is essential for the recruitment of tumor-associated neutrophils (TANs), which subsequently suppress antitumor T-cell responses. Elevated levels of CXCR2 ligands, particularly CXCL5, are observed in both human and mouse pancreatic ductal adenocarcinoma (PDA). PMID: 27737879
  9. Complete Freund's adjuvant increases CXCL1 and CXCR2 expression in the dorsal root ganglion, with cellular distribution observed in neurons of all sizes. Moreover, specific inhibition of CXCR2 in the dorsal root ganglion attenuates established inflammatory pain. PMID: 27697507
  10. The postnatal development of the intestinal microbiota is a significant susceptibility factor for experimental biliary atresia, a process that involves Cxcr2 signaling. PMID: 28763485
  11. CXCR2-driven activation of NLRP3 inflammasome in macrophages plays a crucial role in the development of inflammatory responses associated with excessive proinflammatory IL-1beta production. This suggests a potential therapeutic target to limit damaging inflammation. PMID: 28739876
  12. The upregulation of CCRL2 observed during inflammatory conditions functionally fine-tunes CXCR2-mediated neutrophil recruitment at sites of inflammation. PMID: 28743719
  13. RelA plays a role in regulating oxidative stress in preneoplastic lesions. The RelA/CXCL1/CXCR2 axis serves as a critical mechanism of tumor surveillance in pancreatic ductal adenocarcinoma. PMID: 27454298
  14. TNFalpha-activated mesenchymal stromal cells contribute to breast cancer metastasis by recruiting neutrophils. PMID: 27375023
  15. CXCR2 network and CXCL4 play a crucial role in maintaining normal hematopoietic stem cell (HSC)/hematopoietic progenitor cell (HPC) cell fates, including survival and self-renewal. PMID: 27222476
  16. Gastrin-releasing peptide receptor antagonist may hold potential for treating drug-induced liver injury by modulating adhesion molecules and potentially directly binding to CXCR2. PMID: 28294319
  17. Astragaloside IV alleviates E. coli-caused peritonitis by modulating GRK2-CXCR2 signaling in neutrophils. PMID: 27543854
  18. CXCR2 signaling within the myeloid compartment promotes tumor growth and is essential for pancreatic cancer metastasis. PMID: 27265504
  19. The CXCR2/CXCL1 axis promotes granulocytic myeloid-derived suppressor cell recruitment and facilitates arginase I expression and activity of these cells at the maternal-fetal interface. PMID: 27027573
  20. CXCR2 plays a critical role in particle-induced osteolysis. PMID: 26939934
  21. Endothelial CXCR2 plays essential roles in cerebral endothelial activation and subsequent leukocyte recruitment during neuroinflammation. PMID: 25990934
  22. TLR4 deletion on dendritic cells (DCs) during intra-abdominal polymicrobial sepsis is associated with lower IL-10 levels, increased polymorphonuclear leukocyte (PMN) accumulation in the peritoneal cavity, and higher CXCR2 expression. PMID: 26603204
  23. The distribution of CXCL1 monomers and dimers is tightly coupled with receptor interactions, regulating neutrophil trafficking. Injury in the context of disease is a consequence of inappropriate CXCR2 activation. PMID: 26138727
  24. p53-mediated induction of plasminogen activator inhibitor-1 (PAI-1) expression due to chronic cigarette smoke (CS) exposure exacerbates lung inflammation through the release of CXCL1, CXCL2, and subsequent CXCR2 activation. PMID: 26747783
  25. Chemotherapy-specific differential regulation of CXCR2 ligands, stem cell-like and mesenchymal phenotypes, and enhanced metastasis in drug-resistant cells suggests that targeting CXCR2 signaling may circumvent therapy resistance in breast cancer. PMID: 26797460
  26. Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils. PMID: 26297794
  27. Blockade of CXCR2 during Haemophilus influenzae type b (Hib) challenge infection replicates the delayed wound repair observed in helminth-infected Aid-/- and Fcrg-/- mice. PMID: 25806513
  28. CXCR2 and CX3CR1 differentially regulate endothelial progenitor cell (EPC) functional responses during atheroregression. PMID: 25765938
  29. CXCr2 regulates the hepatic proliferative response and subsequent liver regeneration. PMID: 25756662
  30. Research indicates a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis. PMID: 25622052
  31. CXCR2 antagonism reduces neurological deficits and infarct volumes that are exacerbated in hyperlipidemic ApoE-/- mice. PMID: 26337969
  32. LPS-induced induction of G protein-coupled receptor kinase 2 (GRK2) and down-regulation of CXCR2 are significantly attenuated in PLD2(-/-) mice. PMID: 26282875
  33. CXCR2 plays a critical role in the development of acute and chronic pancreatitis in mice. Inhibition or loss of CXCR2 protects against pancreatic damage. PMID: 25950520
  34. CXCR2 regulates bone marrow blood vessel repair/regeneration and hematopoietic recovery, suggesting a potential therapeutic target for improving bone marrow transplantation. PMID: 25757087
  35. ADAM17 induction down-regulates CXCR2 in an irreversible manner and may serve as a master switch in controlling CXCR2 function. PMID: 25412626
  36. CXCR2-dependent signaling regulates mammary tumor growth and metastasis by promoting angiogenesis and pro-inflammatory responses. PMID: 25511644
  37. Studies have investigated the expression and function of chemokine receptors CXCR2 and CXCR7 in rats with acute leukemia. PMID: 25063073
  38. Macrophages and beta-cells produce CXCL1 and CXCL2, recruiting CXCR2-expressing neutrophils from the blood to the pancreatic islets. PMID: 24968718
  39. KC and/or CXCR2 contribute to the pathogenesis of globoid-cell leukodystrophy. PMID: 23755134
  40. shRNA-induced HIF-1alpha and IL-8 knockdown inhibits angiogenesis and tumor growth in hepatocellular carcinoma. PMID: 24321089
  41. In TPA-induced skin inflammation, macrophage migration inhibitory factor (MIF) is released from damaged keratinocytes, triggering the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. PMID: 25172501
  42. Disruption of CXCR2-mediated myeloid-derived suppressor cell tumor trafficking enhances anti-PD1 efficacy in rhabdomyosarcomas. PMID: 24848257
  43. IBE-elicited signals increase SDF-1 expression through the CXCR2/miR-223/miR-27b pathway in C6 astrocytoma cells and primary astrocytes. PMID: 24999035
  44. Lung cancer promotion by inflammation is partly mediated by activation of the IL-8/CXCR2 pathway, leading to the recruitment of neutrophils and release of neutrophil elastase. PMID: 24321240
  45. CXCR2 and leukotriene B4 receptor BLT1 play a key role in neutrophil recruitment during the development of imiquimod (IMQ)-induced psoriatic skin lesions in mice. PMID: 24663678
  46. Combined inhibition of CXCR2 and sulindac treatment holds therapeutic potential for colon cancer prevention. PMID: 24338666
  47. CXCR2, the primary receptor of CXCL1, is upregulated in dorsal horn neurons in neuropathic pain. PMID: 23831863
  48. GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at various levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane. PMID: 24510965
  49. IL-33 cooperates with IL-17A to exacerbate airway hyperresponsiveness by enhancing neutrophilic inflammation via CXCR2 signaling. Moreover, CXCR2 signaling contributes to Th2 responses. PMID: 24446518
  50. KC/IL-8 and its receptor CXCR2 are critical mediators of organ cross-talk in dextran sulfate sodium (DSS) colitis. Neutralization of CXCR2 could help reduce the incidence of acute kidney injury associated with ulcerative colitis and Crohn's disease in humans. PMID: 23986515

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse CXCR2?

Mouse CXCR2 (also known as Cmkar2, Gpcr16, Il8rb) is a G-protein-coupled receptor consisting of 359 amino acids with seven transmembrane domains. The full sequence is: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLLSLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKIFSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPILILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEEILGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL .

The protein contains specific binding domains for its ligands, primarily CXC chemokines. These structural features determine its specificity and function in immune cell chemotaxis and inflammatory responses. The receptor's intracellular domains couple to G-proteins to initiate downstream signaling cascades upon ligand binding.

What are the primary ligands for mouse CXCR2?

Mouse CXCR2 binds several CXC chemokines, with CXCL1 (KC, keratinocyte-derived chemokine) and CXCL2/3 (MIP-2, macrophage inflammatory protein 2) being the principal ligands . These are functional homologues of human growth-related oncogenes (GROα, -β, and -γ). The ligand-receptor interaction triggers intracellular signaling cascades that regulate various cellular functions, particularly chemotaxis.

The binding specificities of mouse CXCR2 differ slightly from human CXCR2, which has implications for translational research. The affinity of these interactions can be measured using recombinant proteins in binding assays with radiolabeled or fluorescently labeled ligands.

What is the normal expression pattern of CXCR2 in mouse tissues?

CXCR2 is predominantly expressed on neutrophils but is also found on various other cell types. Expression has been characterized in:

  • Immune cells: neutrophils, mast cells, monocytes, and macrophages

  • Endothelial cells: mediating angiogenesis

  • Epithelial cells

  • Neuroendocrine tissues: pituitary gland, adrenal medulla, pancreatic islet cells, thyroid C cells

  • Gastrointestinal system: Kulchitsky cells of the bronchi, neuroendocrine cells in the stomach, small bowel, colon, and appendix

The expression pattern can be altered in pathological conditions, with increased expression commonly observed in inflammation and cancer. Quantitative analysis of CXCR2 expression can be performed using flow cytometry, immunohistochemistry, or RT-PCR in specific tissue samples.

How should recombinant mouse CXCR2 protein be reconstituted and stored?

Proper handling of recombinant mouse CXCR2 is crucial for maintaining its biological activity. Follow these recommendations:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C to -80°C

The reconstituted protein should be used in Tris/PBS-based buffer at pH 8.0. Protein activity decreases with each freeze-thaw cycle, so creating single-use aliquots is recommended for maintaining consistency across experiments.

What are the optimal conditions for studying CXCR2 function in vitro?

When designing in vitro experiments to study CXCR2 function:

  • Cell selection: Choose appropriate cell types expressing CXCR2 (neutrophils, macrophages) or transfected cell lines with stable CXCR2 expression

  • Buffer composition: Use physiological buffers (HBSS, PBS with Ca²⁺/Mg²⁺) supplemented with 0.1% BSA

  • Temperature: Maintain cells at 37°C during functional assays

  • Controls: Include both positive controls (known CXCR2 ligands like CXCL1/KC) and negative controls (buffer alone)

  • Inhibitor studies: When using CXCR2 antagonists like SB-225002, establish proper dose-response curves (1.5-15 μg/g has been used in vivo)

For chemotaxis assays, Transwell systems with 3-5 μm pore size are appropriate for neutrophils, while larger pores may be needed for macrophages. Cell migration should be assessed after 1-3 hours of incubation.

How can recombinant mouse CXCR2 be used in binding studies?

Binding studies with recombinant CXCR2 can provide valuable information about ligand specificity and affinity. A methodological approach includes:

  • Direct binding assays: Use radiolabeled (I¹²⁵) or fluorescently labeled chemokines

    • Incubate with recombinant CXCR2 (100-500 ng per reaction)

    • Wash to remove unbound ligand

    • Measure bound ligand via scintillation counting or fluorescence detection

  • Competition binding assays:

    • Pre-incubate labeled reference ligand with CXCR2

    • Add increasing concentrations of unlabeled test compound

    • Calculate IC₅₀ and Ki values using nonlinear regression

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant CXCR2 on a sensor chip

    • Flow ligands over the surface at various concentrations

    • Analyze association and dissociation kinetics for affinity determination

When interpreting binding data, consider that the His-tag on recombinant CXCR2 may affect binding properties and should be cleaved if possible for certain applications.

How does CXCR2 contribute to inflammation and infection responses?

CXCR2 plays critical roles in both acute and chronic inflammatory conditions:

  • Neutrophil recruitment: CXCR2 mediates neutrophil migration to sites of inflammation through chemokine gradients

  • Bacterial infections: In Streptococcus pneumoniae infections, CXCR2 is essential for both neutrophil and exudate macrophage recruitment. CXCR2 knockout mice show:

    • Severe impairment of neutrophil and macrophage recruitment

    • Massive bacterial outgrowth in lung airspaces

    • 100% mortality within 3 days of infection

  • Threshold effect: Even a 10-25% reduction in CXCR2-mediated neutrophil recruitment is sufficient to impair bacterial clearance and increase mortality in pneumococcal infections

  • Respiratory conditions: CXCR2 is implicated in acute lung injury (ALI), asthma, chronic obstructive pulmonary disease (COPD), and cystic fibrosis (CF) through:

    • Neutrophil recruitment to lungs

    • Increased airway microvascular leakage

    • Lung edema

    • Mucus hypersecretion and goblet cell hyperplasia

For studying these mechanisms, chimeric mouse models with varying degrees of CXCR2 deficiency (10%, 25%, 50%, 75%) provide valuable insights into threshold requirements for immune protection.

What experimental approaches are effective for studying CXCR2 in cancer models?

CXCR2 is increasingly recognized as an important factor in cancer biology, particularly in:

  • Tumor angiogenesis: CXCR2 mediates endothelial cell migration and proliferation

  • Tumor growth: CXCR2 and its ligands can directly stimulate proliferation of cancer cells

  • Pancreatic cancer: CXCR2 inhibition shows promising results in reducing tumor growth

Experimental approaches should include:

  • In vitro models:

    • Cell proliferation assays with CXCR2-expressing cancer cell lines

    • Angiogenesis assays (tube formation, endothelial cell migration)

    • 3D organoid cultures to assess tumor-stromal interactions

  • In vivo models:

    • Orthotopic pancreatic cancer models

    • Patient-derived xenografts

    • Genetic models (CXCR2 knockout or conditional knockout)

    • Pharmacological inhibition (CXCR2 antagonists at 1.5-15 μg/g body weight)

  • Analysis methods:

    • Immunohistochemistry for CXCR2 expression in tumor tissues

    • Flow cytometry for infiltrating immune cells

    • Cytokine/chemokine profiling of tumor microenvironment

When designing such experiments, consider the complex roles of CXCR2 in both tumor cells and stromal components, including immune cells and endothelial cells.

How should researchers interpret contradictory data regarding CXCR2 function in different disease models?

CXCR2 exhibits context-dependent functions that may appear contradictory:

  • Tissue-specific effects: CXCR2 function differs between tissues. For example, CXCR2 knockout mice show defective neutrophil recruitment to peripheral sites but can still localize neutrophils to the CNS during inflammatory demyelination

  • Disease-specific roles: In sepsis, CXCR2 expression on neutrophils decreases, yet blocking CXCR2 reduces liver injury and mortality without affecting bacterial clearance

  • Cell type-dependent functions: CXCR2 mediates different responses in neutrophils versus endothelial cells or tumor cells

To address these complexities:

  • Use multiple models: Compare CXCR2 function across different disease models and tissues

  • Cell-specific approaches: Employ conditional knockout models targeting specific cell types

  • Temporal considerations: Examine acute versus chronic effects using inducible systems

  • Dose-response relationships: Test varying degrees of CXCR2 inhibition (10-75% as demonstrated in chimeric models)

  • Comprehensive readouts: Measure multiple parameters beyond cell recruitment, including tissue damage, organ function, and survival

A thorough experimental design should account for these variables and include appropriate controls for each condition studied.

What methods are available for validating CXCR2 knockout or knockdown in experimental models?

Proper validation of CXCR2 genetic manipulation is essential for accurate data interpretation:

  • Genotyping: PCR-based detection of the targeting construct in genomic DNA

  • Expression analysis:

    • RT-qPCR for mRNA quantification

    • Western blot for protein expression

    • Flow cytometry to assess surface expression on specific cell populations

  • Functional validation:

    • Chemotaxis assays using CXCR2 ligands (CXCL1/KC, CXCL2/MIP-2)

    • Calcium flux measurement upon ligand stimulation

    • In vivo neutrophil recruitment in response to inflammatory stimuli

  • Chimeric models: For partial knockouts, flow cytometric analysis with markers distinguishing donor populations plus functional assays at different chimeric ratios (10:90, 25:75, 50:50, 75:25 [KO:WT])

Results should be compared with both wild-type and established CXCR2 knockout controls. For knockdown models, include scrambled/non-targeting controls and validate the specificity of targeting sequences.

What are the key considerations when designing experiments with CXCR2 antagonists?

CXCR2 antagonists like SB-225002 are valuable tools but require careful experimental design:

  • Dosing considerations:

    • Establish dose-response relationships (1.5-15 μg/g body weight has been used in vivo)

    • Consider pharmacokinetics for dosing frequency (e.g., twice daily administration)

    • Route of administration affects bioavailability (intraperitoneal versus intravenous)

  • Specificity controls:

    • Include vehicle controls

    • Test effects on CXCR2 knockout cells/animals to identify off-target effects

    • Consider testing related receptors (CXCR1) to confirm specificity

  • Timing of administration:

    • Preventive (pre-disease) versus therapeutic (post-disease onset) protocols

    • Acute versus chronic treatment regimens

  • Readouts:

    • Direct CXCR2 blockade (receptor occupancy assays)

    • Functional consequences (neutrophil/macrophage recruitment)

    • Disease-specific endpoints (bacterial burden, tumor growth)

    • Survival outcomes

The experimental design should match the research question—whether examining prophylactic potential, therapeutic efficacy, or mechanism of action.

What experimental models are most appropriate for studying the dual role of CXCR2 in neutrophil and macrophage recruitment?

Recent research has revealed CXCR2's unexpected role in regulating both neutrophil and exudate macrophage recruitment, particularly in pneumococcal pneumonia . To study this dual function:

  • In vivo infection models:

    • Bacterial pneumonia models using Streptococcus pneumoniae

    • Dose: approximately 3 × 10⁶ CFU/mouse via intratracheal instillation

    • Time points: 24, 48, and 72 hours post-infection

  • Cell recruitment analysis:

    • Bronchoalveolar lavage (BAL) for counting and differentiating infiltrating cells

    • Flow cytometry to distinguish neutrophils (Ly6G+) from exudate macrophages (CD11b+F4/80+)

    • Histological examination of lung tissues

  • Chimeric approaches:

    • Bone marrow transplantation with varying ratios of CXCR2 KO:WT cells (10:90, 25:75, 50:50, 75:25)

    • This allows determination of threshold levels required for protection

  • Pharmacological models:

    • CXCR2 antagonist (SB-225002) at defined doses (1.5 or 15 μg/g body weight)

    • Administration schedule: twice daily, starting before infection

  • Readouts:

    • Bacterial burden in lungs (CFU counts)

    • Inflammatory cell counts and differentiation

    • Chemokine profiling in BAL fluid

    • Survival monitoring

These approaches have revealed that even modest reductions in CXCR2 function (10-25%) significantly impair both neutrophil and macrophage recruitment, with profound consequences for bacterial clearance and survival .

How should researchers address common technical challenges with recombinant CXCR2 protein?

Working with transmembrane proteins like CXCR2 presents several technical challenges:

  • Solubility issues:

    • Use appropriate detergents (0.1% DDM or 0.5% CHAPS)

    • Consider using nanodiscs or liposomes for functional studies

    • Avoid repeated freeze-thaw cycles which cause protein aggregation

  • Activity loss:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add glycerol (final concentration 5-50%) for long-term storage

    • Aliquot and store at -80°C to minimize damage from freeze-thaw cycles

  • Binding inconsistencies:

    • Ensure proper protein folding through circular dichroism analysis

    • Verify N-terminal accessibility (critical for ligand binding)

    • Consider the impact of His-tag on binding properties

  • Purity concerns:

    • Verify >90% purity by SDS-PAGE before experiments

    • Consider size-exclusion chromatography to remove aggregates

    • Test for endotoxin contamination, especially for in vivo applications

When troubleshooting, systematically test each parameter (buffer conditions, temperature, protein concentration) while maintaining appropriate positive and negative controls.

How can researchers distinguish between direct and indirect effects of CXCR2 inhibition in complex disease models?

Separating direct and indirect effects of CXCR2 inhibition requires careful experimental design:

  • Cell-specific knockout models:

    • Conditional CXCR2 knockout in specific cell types (neutrophils, endothelial cells, epithelial cells)

    • Compare phenotypes with global knockout to identify cell-specific contributions

  • Bone marrow chimeras:

    • Transplant CXCR2 KO bone marrow into wild-type recipients and vice versa

    • This separates hematopoietic from non-hematopoietic CXCR2 functions

  • Temporal inhibition:

    • Use inducible knockout systems or time-limited antagonist treatment

    • This helps distinguish between developmental effects and acute responses

  • Combined approaches:

    • Pharmacological inhibition in genetic models lacking CXCR2 in specific compartments

    • This reveals additive or synergistic effects across different cell types

  • Mechanistic readouts:

    • Measure direct CXCR2 signaling (calcium flux, ERK phosphorylation)

    • Assess secondary mediators that might amplify or propagate effects

    • Monitor temporal sequence of cellular and molecular events

In pancreatic cancer models, for example, distinguishing between CXCR2's effects on tumor cells versus stromal components requires these approaches to fully understand the therapeutic potential of CXCR2 inhibition .

What are the emerging research areas for CXCR2 beyond current applications?

Several promising research directions are emerging for CXCR2:

  • Precision targeting approaches:

    • Cell-specific CXCR2 modulation to minimize side effects

    • Biased ligands that activate beneficial pathways while avoiding detrimental ones

    • Temporal control of CXCR2 inhibition in acute versus chronic conditions

  • Combination therapies:

    • CXCR2 inhibitors with conventional chemotherapy for pancreatic cancer

    • Combined targeting of multiple chemokine receptors (CXCR2 + CCR2)

    • CXCR2 blockade with immunotherapy approaches

  • Novel disease applications:

    • Neurodegenerative disorders where CXCR2+ neutrophils contribute to pathology

    • Metabolic diseases with inflammatory components

    • Fibrotic conditions beyond currently studied models

  • Translational considerations:

    • Biomarkers to identify patients likely to respond to CXCR2-targeted therapies

    • Strategies to overcome compensatory mechanisms during chronic CXCR2 blockade

    • Improved drug delivery systems for tissue-specific targeting

  • Structural biology:

    • Detailed mapping of binding sites for different ligands

    • Structure-based drug design for improved antagonists

    • Allosteric modulators of CXCR2 function

These directions build upon the foundation of CXCR2 biology in inflammation and cancer while expanding into new therapeutic frontiers.

What key questions remain unresolved in CXCR2 biology?

Despite extensive research, several fundamental questions about CXCR2 remain unanswered:

  • Signaling complexity:

    • How do different ligands induce distinct signaling outcomes through the same receptor?

    • What determines cell type-specific responses to CXCR2 activation?

    • How does CXCR2 signaling integrate with other inflammatory pathways?

  • Dual cell recruitment role:

    • What is the molecular mechanism by which CXCR2 regulates both neutrophil and macrophage recruitment?

    • Are these effects direct or indirect through secondary mediators?

    • How do these functions vary across different tissues and disease states?

  • Therapeutic implications:

    • What is the optimal degree of CXCR2 inhibition that provides therapeutic benefit without compromising host defense?

    • Can CXCR2 be targeted in a tissue-specific manner to reduce side effects?

    • What patient populations would benefit most from CXCR2-targeted therapies?

  • Evolutionary considerations:

    • Why has CXCR2 evolved to have such diverse roles across multiple cell types?

    • How do mouse models translate to human CXCR2 biology given differences in ligand specificity?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.